KEGG   Haemophilus influenzae R2846 (nontypeable): R2846_0593Help
Entry
R2846_0593        CDS       T01980                                 

Definition
(GenBank) Putative zinc-type alcohol dehydrogenase
Organism
hie  Haemophilus influenzae R2846 (nontypeable)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C DAO HI0933_like FAD_binding_2 Pyr_redox_2 FAD_binding_3 Pyr_redox NADH_4Fe-4S 3HCDH_N UDPG_MGDP_dh_N NAD_binding_8 FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: ADO96014
LinkDB All DBs
Position
601494..602522
Genome map
AA seq 342 aa AA seqDB search
MKERIKAICLEKPNNVVVKEVPYPEKSDNDVLIQVESMGICGSDIGAYRGTNPLVTYPRI
LGHEIVGRVIESGIGMPDRVRVGDRVIVDPYVFCGQCYPCSIGRTNCCESLKVIGVHIDG
GMQEVIRHPAHLLTKVPDNLPIHQLPLAEPLTIALHALHRTTLKSGEHIVIIGAGAIGLM
AALAAVQYGAIPILVDILEQRLEYAKSLGIEHIVNPHKEDDIKRIKEITSGRMAEVVMEA
SGANISIKNTLHYTSFAGRIALTGWPKTETPLPTNLITFKELNIYGSRTSKGEFEEALDM
LATNKINASHIITKCIKFEEIPSFISDLSDHPENYLKINAVF
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaaggagcgaatcaaagcaatatgcttagaaaaaccaaacaatgtagttgttaaagaa
gtgccttatcccgagaaaagtgataatgatgtacttattcaggtagaatcaatggggatt
tgtggttctgatattggtgcatatagaggaactaatccattagtaacttatccaagaata
cttgggcatgaaattgtagggagagtaattgaaagtggaattggtatgccggatagggtg
agggttggagaccgagtaattgttgatccttatgttttttgtggtcaatgctatccttgt
tcaattggtagaaccaattgttgtgaatcattaaaggtaattggtgttcatattgatgga
ggtatgcaagaggtaattagacatcccgctcatcttttaactaaagtcccagataaccta
ccgattcatcaattacctttagctgaacctttaacaatagctttacatgctttacataga
acaactttaaaatcaggggaacacatagtaattattggagctggtgcaattggattaatg
gcagcattagcagcggttcaatatggagcaatcccaattttagttgatatattagaacaa
cgtcttgagtatgcaaaatccttgggaattgaacatattgtaaatccgcataaggaggat
gacattaaaagaattaaggaaattacaagtggtcgtatggcagaagttgttatggaggca
tctggtgctaatatttctatcaaaaatactctgcattatacctcctttgcaggaagaatt
gctttaacaggatggccaaaaacagaaactccattaccaacaaatttaattacctttaaa
gaattgaatatttatggttctagaacaagcaagggggaatttgaggaggcattggatatg
cttgctactaataaaattaatgcatctcatatcattactaagtgtatcaaatttgaagaa
attcctagttttatttctgatttatctgatcatccagaaaattatttaaaaattaatgca
gttttctaa

DBGET integrated database retrieval system