KEGG   Haemophilus influenzae F3031 (nontypeable): HIBPF_20380Help
Entry
HIBPF_20380       CDS       T01395                                 

Definition
(GenBank) shikimate kinase I
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
hif  Haemophilus influenzae F3031 (nontypeable)
Pathway
hif00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hif01100  Metabolic pathways
hif01110  Biosynthesis of secondary metabolites
hif01130  Biosynthesis of antibiotics
hif01230  Biosynthesis of amino acids
Module
hif_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:hif00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HIBPF_20380
Enzymes [BR:hif01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     HIBPF_20380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_18 Cytidylate_kin2 AAA_33 Cytidylate_kin dNK AAA_17 AAA TsaE AAA_22 AAA_16 AAA_24 ABC_tran CoaE APS_kinase AAA_7 Ploopntkinase3 AAA_5 AAA_PrkA RNA_helicase Cas_Csm6 IstB_IS21 AAA_29 AAA_28 Zeta_toxin AAA_14 Mg_chelatase
Motif
Other DBs
NCBI-ProteinID: CBY82065
UniProt: E7A7M1
LinkDB All DBs
Position
1950657..1951199
Genome map
AA seq 180 aa AA seqDB search
MAEKRNIFLVGPMGAGKSTIGRQLAQQLNMDFIDSDAVIEERTGADISWIFDLEGEDGFR
KREERIINELTQMQGIVLSTGGGAVLSKENRNYLSARGIVIYLETTVEKQFQRTQRDKKR
PLLQDAENPRQVLEDLAKIRNPLYEEIADITLPTDEQNAKIMVNQIVDLIDNMNGLNGAL
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaaaacgtaatatttttttagtaggaccaatgggtgcaggtaaaagtactatc
ggtcgtcaattagcacaacagcttaatatggattttattgattccgatgcagtgattgaa
gaacgtacgggcgcggatattagctggatttttgatttggaaggcgaagacggcttccga
aaacgtgaagaacgcattattaacgaactcacacaaatgcaaggtattgtcctttcaact
ggtgggggcgcagtgctttctaaggaaaaccgtaattatttatcagcacgtggtattgta
atttatttagaaacaacggtggaaaaacaattccaacgcactcaacgtgataaaaaacgt
ccattgctccaagatgcagagaatcctcgtcaagtattggaagatttagcaaaaattcgc
aatccgctttatgaagaaattgcggacatcactttgccaaccgatgaacaaaatgccaaa
ataatggtaaatcaaattgttgatttaattgataatatgaatgggttgaatggtgcactt
taa

DBGET integrated database retrieval system