KEGG   Haemophilus influenzae Hi375: NF38_01705Help
Entry
NF38_01705        CDS       T03485                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
hih  Haemophilus influenzae Hi375
Pathway
hih00564  Glycerophospholipid metabolism
hih01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hih00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    NF38_01705
Enzymes [BR:hih01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     NF38_01705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Fer2_BFD FAD_binding_2 DAO_C FAD_binding_3 Thi4 Pyr_redox_2 3HCDH_N NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AIT66980
UniProt: A0A112WFG2
LinkDB All DBs
Position
353025..354716
Genome map
AA seq 563 aa AA seqDB search
MGLSPSIYKDVGDLSSLSTDVIIIGGGATGAGIVRDCALRGIDCILLERRDIATGATGRN
HGLLHSGARYAVNDQESAEECIKENRILRKIARHCVDETEGLFITLPEDSLDYQKTFLES
CAKSGIDAQAIDPDLAKIMEPSVNPDLVGAVVVPDGSIDPFRLTASNMMDATENGAKMFT
YCEVKNLIREGGKVIGVNVYDHKNRRERQFFAPLVVNAGGIWGQGIAEYADLKIKMFPAK
GALLVMGHRINKLVINRCRKPADADILVPGDTICVIGTTSSRIPYDQIDNMEVTPEEVDI
LFREGEKLAPSLRHTRVLRAYAGVRPLVASDDDPSGRNVSRGIVLLDHAERDGLDGFITI
TGGKLMTYRLMAEWATDLVCKKLNKTARCVTAEQPLPGSTESRQETNQKVISLPSTIRYS
AVYRHGSRATRLLEKERLDRSMVCECEAVTAGEVRYAIDELDVNNLVDLRRRSRVGMGTC
QAELCACRAAGLMNRFEVATPRQSTTQLSAFMEERWRGIEPIAWGEAIREAEFTSWMYGS
VLGLNDVKPLDEQAQQGTDSNEF
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgggattatcgcctagtatctataaagatgttggagatctttcgtcacttagcactgat
gtgatcattatcggtggtggcgcaacaggagcaggtattgtgcgcgattgcgcacttcgt
ggcattgattgtattttattggaacgtcgagatattgcgacaggagccacaggacgtaac
cacggattattacacagtggtgcacgttacgccgtgaacgaccaagaatctgctgaagaa
tgtattaaagaaaaccgcattttgcgcaaaattgcgcgtcattgcgtagatgaaacggaa
ggcttatttatcactttgcctgaagattcgctcgactatcaaaaaaccttccttgagagc
tgtgcaaaatctggaattgatgcacaagctattgatcctgatttagctaaaattatggag
ccttctgtaaaccctgatttagtgggcgctgttgttgtgccagatggttctattgaccca
ttccgtttaaccgcctctaatatgatggacgccacagaaaacggcgcaaaaatgttcact
tattgcgaagtaaaaaatttgattcgtgaaggtggaaaagtgattggcgtgaatgtgtac
gatcacaaaaatcgcagagaacgccaattttttgcaccgcttgttgtaaatgctggtggt
atttggggacaagggattgcggaatatgccgatctcaaaattaaaatgttccctgcaaaa
ggcgcattactcgtaatgggtcatcgcattaataaacttgtaattaaccgctgccgtaaa
cctgctgatgcggatattctcgtccctggcgatacaatttgtgtgatcggaacaacatct
agccgcattccttatgatcaaattgataatatggaagtaacaccagaggaagtggatatt
cttttccgtgaaggtgaaaaactcgcacctagcttgcgtcatactcgcgtattacgtgct
tatgctggggtgcgaccattagttgcaagcgatgatgatccatcaggtcgaaatgtgagt
cgtggtatcgtgctacttgaccacgcagaacgtgatggcttagatggctttattactatc
actggcggtaagttaatgacttatcgtttaatggctgaatgggcgactgaccttgtttgt
aaaaaactcaataaaacggcacgttgtgtgactgcagagcaacctttgccaggctctact
gaaagtcgtcaagagaccaatcaaaaagtcatttcattaccaagtactattcgttattct
gccgtatatcgtcacggttcacgggctactcgtttgcttgaaaaagaacgtttagatcgt
tcaatggtttgcgaatgtgaagcggtaacagcgggggaagttcgttacgctattgatgaa
ctggatgtaaataatctcgtcgatttacgtcgtcgctcccgagttggaatgggaacttgt
caagctgaactctgtgcgtgtcgtgccgcaggactaatgaatcgttttgaagtggcaaca
ccacgtcaatcaactactcaactttccgcctttatggaagaacgctggcgtggtattgaa
ccgattgcttggggggaagctattcgcgaagccgaatttacctcttggatgtatggtagt
gtattaggtttaaatgatgtgaaaccgcttgatgaacaagcacaacaagggacggatagc
aatgaattttga

DBGET integrated database retrieval system