KEGG   Haemophilus influenzae Hi375: NF38_04390Help
Entry
NF38_04390        CDS       T03485                                 

Gene name
aroK
Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
hih  Haemophilus influenzae Hi375
Pathway
hih00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hih01100  Metabolic pathways
hih01110  Biosynthesis of secondary metabolites
hih01130  Biosynthesis of antibiotics
hih01230  Biosynthesis of amino acids
Module
hih_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:hih00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NF38_04390 (aroK)
Enzymes [BR:hih01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     NF38_04390 (aroK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_18 Cytidylate_kin2 AAA_33 Cytidylate_kin dNK AAA_17 AAA TsaE AAA_16 AAA_22 AAA_24 ABC_tran CoaE APS_kinase AAA_7 Ploopntkinase3 AAA_5 AAA_PrkA RNA_helicase IstB_IS21 AAA_29 AAA_28 Cas_Csm6 Zeta_toxin AAA_14 Mg_chelatase
Motif
Other DBs
NCBI-ProteinID: AIT67468
UniProt: A0A0D0GZE9
LinkDB All DBs
Position
complement(870875..871417)
Genome map
AA seq 180 aa AA seqDB search
MAEKRNIFLVGPMGAGKSTIGRQLAQQLNMDFIDSDAVIEERTGADISWIFDLEGEDGFR
KREERIINELTQMQGIVLSTGGGAVLSKENRNYLSARGIVIYLETTVEKQFQRTQRDKKR
PLLQDAENPRQVLEDLAKIRNPLYEEIADITLPTDEQNAKVMVNQIVDLIDNMNGLNGAL
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaaaacgtaatatttttttagtaggaccaatgggtgcaggtaaaagtactatc
ggtcgtcaattagcacaacagcttaatatggattttattgattccgatgcagtgattgaa
gaacgtacgggcgcggatattagctggatttttgatttggaaggcgaagacggcttccga
aaacgtgaagaacgcattattaacgaactcacacaaatgcaaggtattgtactttcaact
ggtgggggagcagtgctttctaaggaaaaccgtaattatttatcagcacgtggtattgta
atttatttagaaacaacggtggaaaaacaattccaacgcactcaacgtgataaaaaacgt
ccattgctccaagatgcagagaatcctcgtcaagtattggaagatttagcaaaaattcgc
aatccgctttatgaagaaattgcggacatcactttgccaactgatgaacaaaatgccaaa
gtaatggtaaatcaaattgttgatttaattgataatatgaatggattaaatggtgcgctt
taa

DBGET integrated database retrieval system