KEGG   Haemophilus influenzae Hi375: NF38_05570Help
Entry
NF38_05570        CDS       T03485                                 

Definition
(GenBank) enoyl-ACP reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
hih  Haemophilus influenzae Hi375
Pathway
hih00061  Fatty acid biosynthesis
hih00780  Biotin metabolism
hih01100  Metabolic pathways
hih01130  Biosynthesis of antibiotics
hih01212  Fatty acid metabolism
Module
hih_M00083  Fatty acid biosynthesis, elongation
hih_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:hih00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    NF38_05570
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    NF38_05570
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    NF38_05570
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:hih01004]
    NF38_05570
Enzymes [BR:hih01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     NF38_05570
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     NF38_05570
Lipid biosynthesis proteins [BR:hih01004]
 Fatty acid synthase
  Component type
   NF38_05570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short DUF4570
Motif
Other DBs
NCBI-ProteinID: AIT67676
UniProt: A0A1Q5Y3C0
LinkDB All DBs
Position
1117507..1118295
Genome map
AA seq 262 aa AA seqDB search
MGFLTGKRILVTGLASNRSIAYGIAKSMKEQGAELAFTYLNDKLQPRVEEFAKEFGSDIV
LPLDVATDESIQNCFAELSKRWDKFDGFIHAIAFAPGDQLDGDYVNAATREGYRIAHDIS
AYSFVAMAQAARPYLNPNAALLTLSYLGAERAIPNYNVMCLAKASLEAATRVMAADLGKE
GIRVNAISAGPIRTLAASGIKNFKKMLSTFEKTAALRRTVTIEDVGNSAAFLCSDLASGI
TGEIVHVDAGFSITAMGELGEE
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgggtttcttaacaggtaaacgcattttagtcacaggtcttgcaagcaatcgttccatc
gcttacgggatcgcaaaatcaatgaaagaacaaggtgcagaacttgctttcacttattta
aacgataaattacaaccgcgcgtagaagaatttgccaaagaatttggttctgatatcgtg
cttcctttagatgtggcaaccgatgaaagcatccaaaactgctttgcagaattaagtaag
cgttgggataaatttgatggttttattcacgcaatcgcatttgcaccaggtgatcaatta
gacggcgattacgtaaatgcggcaactcgtgaaggctatcgtatcgctcatgatattagc
gcatacagctttgttgcaatggcacaagcggcacgtccttacttaaatccaaatgccgca
ttattaacgctttcttatttaggtgcagaacgtgcaattcctaactacaacgtaatgtgc
ctagcaaaagcctctcttgaagctgcaacgcgcgtgatggctgctgatttagggaaagaa
ggtattcgtgtgaatgcaatctctgcaggcccaatccgcaccttagccgcatcaggcatt
aaaaacttcaaaaaaatgctttccacctttgagaaaacggctgcattacgtcgcactgtc
actatcgaagatgtgggtaactcagcggcatttttatgctctgatttagcatcgggcatt
acaggcgaaatcgttcacgttgatgcaggtttcagcatcactgcaatgggcgaattaggc
gaagaataa

DBGET integrated database retrieval system