KEGG   Haemophilus influenzae KR494 (serotype f): HifGL_000663Help
Entry
HifGL_000663      CDS       T02839                                 

Gene name
sodC
Definition
(GenBank) copper/zinc superoxide dismutase SodC
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
hik  Haemophilus influenzae KR494 (serotype f)
Brite
Enzymes [BR:hik01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     HifGL_000663 (sodC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: AGV11494
LinkDB All DBs
Position
complement(674312..674686)
Genome map
AA seq 124 aa AA seqDB search
MFTPNLQGLAEGLHGFHIYENPSCEPKEKDGKLIAGLAAGGHWDSKGAKQHGYPWQDDAH
LGDLPALTVLHDGTATNPVLAPRLKKLDEVRGHSIMIHAGGDNHSDHPAPLGGGGPRMAC
GMIK
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
gtgtttacaccaaatctacaaggtttagctgaaggtttacatggtttccatatttatgaa
aacccaagctgtgaaccaaaagaaaaagacggtaaattaatagcaggtttagcggctggc
ggtcactgggattctaaaggtgcaaaacaacatggttacccatggcaagatgatgctcac
ttaggtgacttaccggctttaacagtattacatgatggtacagcaactaaccctgtttta
gctccacgtcttaaaaaattagatgaagttcgtggtcactctattatgattcacgcaggt
ggcgataaccactcagatcatcctgctccacttggcggtggcggcccacgtatggcatgt
ggcatgattaaataa

DBGET integrated database retrieval system