KEGG   Haemophilus influenzae KR494 (serotype f): HifGL_001399Help
Entry
HifGL_001399      CDS       T02839                                 

Gene name
mrcB
Definition
(GenBank) penicillin-binding protein 1B
  KO
K05365  penicillin-binding protein 1B [EC:2.4.1.129 3.4.16.4]
Organism
hik  Haemophilus influenzae KR494 (serotype f)
Pathway
hik00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:hik00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    HifGL_001399 (mrcB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hik01003]
    HifGL_001399 (mrcB)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:hik01011]
    HifGL_001399 (mrcB)
Enzymes [BR:hik01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     HifGL_001399 (mrcB)
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     HifGL_001399 (mrcB)
Glycosyltransferases [BR:hik01003]
 Polysaccharide
  Bacterial polysaccharide
   HifGL_001399 (mrcB)
Peptidoglycan biosynthesis and degradation proteins [BR:hik01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   HifGL_001399 (mrcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase UB2H UvrB_inter
Motif
Other DBs
NCBI-ProteinID: AGV12194
LinkDB All DBs
Position
1412204..1414549
Genome map
AA seq 781 aa AA seqDB search
MTSQHSAKKSSKNTPKNNRTFKGFLLKFSFTVLVLTIFYGGYLDWQIRSKMDGQIWHLPA
EVYSRLESVKIADNLAFDEVIQILLDNEYRQTTMVAAPGDFKLEDDSIVVLRRAFPFPDK
AEPQRVLRLRFSNNKLSLIEDLVTVKTVDEFRLAPKLIAMLQSDNEDRLAIPLQNYPRLL
IDTLILTEDRRFYEHNGINPVGILRALIANIRAGQTVQGGSTLTQQLVKNLFLSRERTIT
RKANEALMSLVLDWRYDKNRILETYLNEIYLGQNGDTQIHGFELASQFYFGRSIREISLD
QIALLVGMVKGPSLYNPWRNPQNALERRNIVLKLMLEHKMIGDELYQLLSQRPLGVQKKG
QISRKYPAFIQTLQADLRRELGEHKMSSLLGARIFSTMDLKQQAQAENAVVNTVSQLQLK
TKNPHLESAMIITDYRTGEIRAVVGGLQTQYAGFNRALMAKRQIGSLVKPSIYLTALSNP
EQFRLNTLINNQPITINVKGSPPWQPRNYDKKYSGSVMLMDALARSLNIPTVNIGMKVGL
SKVIDTQKAMGWDNVEIPKVPAMLLGSYTISPYDVTKLYQTIANQGGRISLTTVDSITDR
QGNLIFQHDKSVKQVVPQEAAFQTLFAMQQTVERGTARSLQKDYADLHLAGKTGTTNEAR
DTWFVGIDGKNISTVWLGRDDNGETKLTGASGALQIYKDYLNRTNIEKLAITPPATVKWV
GINQYGGWDCESYRTIPVWLNNGQNFCGEISSPSLTPTTETETPPQESLWDVLDNPNPPA
Q
NT seq 2346 nt NT seq  +upstreamnt  +downstreamnt
atgacttctcaacactccgctaaaaaatcatcgaaaaacacgccaaaaaataaccgcact
tttaaaggttttttactgaaatttagtttcactgtgcttgtcttaacgattttttacggc
ggttatctcgattggcaaattcgttctaaaatggatggacaaatttggcatttgcctgcg
gaagtttatagtcgattagaaagtgtgaaaattgccgataatctcgcttttgatgaagtc
attcaaattttattagataacgaatatcgccaaaccacaatggttgccgcccctggcgat
ttcaagttagaagatgatagcattgtagtgcttcgccgtgcttttcctttccccgataaa
gcagaaccacaacgagttttacgtttgcgttttagcaataataagttatctctcattgaa
gatttagtcacagtcaaaactgttgatgaatttcgtcttgcaccaaaattgattgcgatg
ttgcaatcagacaacgaagatcgtttagctattcctttacaaaattatccccgtttatta
attgatacattaattttaacggaagatcgccgcttttatgaacataatggcattaatcca
gtggggattttacgcgcattaattgccaatattcgtgcaggtcaaacggtacagggcggc
agtacgctcactcaacaattagtcaaaaatttatttttatcacgtgaacgcaccattaca
cgcaaagccaacgaagccttgatgtcattggtgttagattggcgttacgataaaaaccgc
attctcgaaacctatctcaatgaaatttatctcggacaaaatggcgatacgcaaattcac
ggttttgaattagccagccaattttattttggtcgttcgattcgtgaaattagcttagat
caaattgcccttttagtggggatggtcaaagggccttcactttataatccgtggcgaaat
ccgcaaaacgccctcgaacgtcgcaacattgttttaaagctaatgcttgagcataaaatg
atcggcgatgaactttatcaattattaagtcagcgacctttaggtgtgcaaaagaaaggg
caaatctcgcgtaaataccctgcatttattcaaactttacaggcagatttacgccgtgaa
ctgggcgaacacaaaatgtcgagcttacttggcgcacgtattttttccacaatggattta
aaacaacaagcccaagcagaaaatgcagtggtcaataccgtttcgcaattacaactgaaa
acgaaaaatccccatttagaaagtgcaatgattataacggattatcgcacaggcgaaatt
cgtgccgtggttggcggtttacaaacccaatatgcaggctttaatcgtgcattaatggca
aaacgtcagattggttctttagtaaaaccttctatttatttgaccgcactttctaatcca
gaacagttccgtttaaataccctaattaataaccagccaattacgattaatgttaaaggt
agcccaccttggcagccacgcaactatgacaaaaaatatagcggttcggtaatgttaatg
gatgccttagcccgttctttaaatattccgacagtgaatattggaatgaaagtcggcttg
agtaaagttattgacacacaaaaagcgatgggctgggataatgtagaaattcctaaagtg
cctgcgatgttactcggttcttataccatctcgccttatgatgtcacaaaactttatcaa
actattgccaatcaaggggggcgaatttcgctcacaaccgtagatagcattactgatcgt
caaggtaacctaatttttcaacacgataaaagcgtaaaacaagtggtgccacaagaagcg
gcattccaaacattatttgcaatgcaacaaactgttgaacgaggcactgcacgtagtttg
caaaaagattacgcagatttacatttagcaggcaaaacaggcacaaccaatgaagctcgc
gatacgtggtttgtgggaattgacggaaaaaatatcagcacagtttggcttggtcgcgat
gataatggcgaaacaaaactgactggtgcttctggcgcattgcaaatttataaagattat
ttaaaccgtacgaatattgaaaaattagcaattacgcctcctgcaacagtgaaatgggtg
gggataaatcaatacggtggctgggattgtgagagttatcgaacaattcctgtttggcta
aataatggtcagaatttctgtggagaaatatcatctccctctctcacgccaacaactgaa
acagaaacaccaccacaagaaagcctgtgggacgtattggataatcccaatccacccgct
caataa

DBGET integrated database retrieval system