KEGG   Haemophilus influenzae F3047 (nontypeable): HICON_04180Help
Entry
HICON_04180       CDS       T01400                                 

Definition
(GenBank) 6-phosphofructokinase I
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
hil  Haemophilus influenzae F3047 (nontypeable)
Pathway
hil00010  Glycolysis / Gluconeogenesis
hil00030  Pentose phosphate pathway
hil00051  Fructose and mannose metabolism
hil00052  Galactose metabolism
hil00680  Methane metabolism
hil01100  Metabolic pathways
hil01110  Biosynthesis of secondary metabolites
hil01120  Microbial metabolism in diverse environments
hil01130  Biosynthesis of antibiotics
hil01200  Carbon metabolism
hil01230  Biosynthesis of amino acids
hil03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:hil00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HICON_04180
   00030 Pentose phosphate pathway
    HICON_04180
   00051 Fructose and mannose metabolism
    HICON_04180
   00052 Galactose metabolism
    HICON_04180
  09102 Energy metabolism
   00680 Methane metabolism
    HICON_04180
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    HICON_04180
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hil01009]
    HICON_04180
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hil03019]
    HICON_04180
Enzymes [BR:hil01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     HICON_04180
Protein phosphatases and associated proteins [BR:hil01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     HICON_04180
Messenger RNA biogenesis [BR:hil03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     HICON_04180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-ProteinID: CBY85881
LinkDB All DBs
Position
164242..165207
Genome map
AA seq 321 aa AA seqDB search
MIKKIAVLTSGGDAPGMNAAIRGVVRSALAEGLEVFGIYDGYQGLYNNKIKQLNRYSVSD
VINRGGTFLGSARFPEFKDPNIRAKCAEILRSHGIDALVVIGGDGSYMGAKLLTEEHSFP
CVGLPGTIDNDVAGTDYTIGYQTALQTAVDAIDRLRDTSSSHQRISIVEIMGRHCSDLTI
SAGIAGGCEYIVASEIEFNREELIQQIERSIIRGKRHAIIAITELLTDVHSLAKEIEARV
GHETRATVLGHIQRGGSPCAFDRILASRMGAYAVDLLLQGKGGYCVGIQNEQLVHHDIID
AINNMQRVFKADWLKVAKRLE
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaaaattgcagttttaacaagtggtggcgatgcgcctggtatgaatgccgca
attcgtggcgtagtacgttctgcacttgcagaaggcttagaagtatttggtatctatgac
ggttatcaaggtttatacaataataaaatcaaacaattaaatcgctatagcgtatctgat
gtgattaatcgtggcggtacttttttaggttctgcacgttttcctgaatttaaagatcct
aatattcgggcaaaatgtgcggaaattttacgttctcacggcattgatgcacttgtggtt
atcggtggtgacggttcttatatgggggcaaaattattaaccgaagaacatagtttccct
tgtgttggcttacccggtactattgataatgatgttgcaggtactgactataccatcggt
tatcaaaccgcattacaaactgcagtggatgcaatcgaccgtttacgtgatacatcaagc
tcacaccaacgtatttctatcgttgaaattatgggtcgccattgtagtgacttaaccatt
tctgcgggcattgctggcggttgtgaatatatcgtcgcatcagaaattgaatttaatcgc
gaagaattaattcaacaaattgaacgtagcattattcgcggtaaacgccacgctattatt
gctatcactgaacttttaactgatgttcattctctggcaaaagaaattgaagctcgcgta
ggtcacgaaactcgcgcaactgttttagggcatattcaacgtggtggttctccttgtgct
tttgaccgtattcttgcctcacgtatgggcgcatacgcagtagatttattgctacaaggc
aagggcggctattgcgtaggtatccaaaatgaacaactcgttcatcacgatattattgat
gccattaataatatgcagcgtgtatttaaggctgattggcttaaagtggcaaaacgtttg
gaataa

DBGET integrated database retrieval system