KEGG   Haemophilus influenzae F3047 (nontypeable): HICON_08030Help
Entry
HICON_08030       CDS       T01400                                 

Definition
(GenBank) sn-glycerol-3-phosphate dehydrogenase (anaerobic), large subunit, FAD/NAD(P)-binding
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
hil  Haemophilus influenzae F3047 (nontypeable)
Pathway
hil00564  Glycerophospholipid metabolism
hil01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hil00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    HICON_08030
Enzymes [BR:hil01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     HICON_08030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO FAD_binding_2 Fer2_BFD FAD_binding_3 DAO_C FAD_oxidored Thi4 Pyr_redox_2 NAD_binding_8 3HCDH_N HI0933_like Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: CBY86269
LinkDB All DBs
Position
589181..590872
Genome map
AA seq 563 aa AA seqDB search
MGLSPSIYKDVGDLSSLSTDVIIIGGGATGAGIARDCALRGIDCILLERRDIATGATGRN
HGLLHSGARYAVNDQESAEECIKENRILRKIARHCVDETEGLFITLPEDSLDYQKTFLES
CAKSGIDAQAIDPELAKIMEPSVNPDLVGAVVVPDGSIDPFRLTASNMMDATENGAKMFT
YCEVKNLIREGGKVIGVNVYDHKNRRERQFFAPLVVNAGGIWGQGIAEYADLKIKMFPAK
GALLVMGHRINKLVINRCRKPADADILVPGDTICVIGTTSSRVPYDQIDNMQVTPEEVDI
LFREGEKLAPSLRHTRVLRAYAGVRPLVASDDDPSGRNVSRGIVLLDHAERDGLDGFITI
TGGKLMTYRLMAEWATDLVCKKLNKTARCVTAEQALPGSTESRQETNQKVISLPSTIRYS
AVYRHGSRATRLLEKERLDRSMVCECEAVTAGEVRYAVDELDVNNLVDLRRRSRVGMGTC
QAELCACRAAGLINRFEVATPRQSTTQLSAFMEERWRGIEPIAWGEAIREAEFTSWMYAS
VLGLNDVKPLDEQAQQGTDSNEF
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgggattatcgcctagtatctataaagatgttggagatctttcgtcacttagcactgat
gtgatcattatcggtggtggcgcaacaggagcaggtattgcgcgcgattgcgcacttcgt
ggcattgattgtattttattggaacgtcgagatattgcgacaggagccacaggacgtaac
cacggattattacacagtggtgcgcgttacgccgtgaacgaccaagaatctgctgaagaa
tgtattaaagaaaaccgcattttacgcaaaattgcgcgtcattgcgtagatgaaacggaa
ggcttatttatcactttgcctgaagattcgctcgactatcaaaaaaccttccttgagagc
tgtgcaaaatctggaattgatgcgcaagccattgatcctgaactagctaaaattatggag
ccttctgtaaaccctgatttagtgggcgctgttgttgtgccagatggttctattgaccca
ttccgtttaaccgcctctaatatgatggacgccacagaaaacggcgcaaaaatgttcact
tattgcgaagtaaaaaatttaattcgtgaaggtggaaaagtgattggcgtgaatgtgtac
gatcacaaaaatcgcagagaacgccaattttttgcaccgcttgttgtaaacgctggtggt
atttggggacaagggattgcggaatatgccgatctcaaaattaaaatgttccctgcaaaa
ggcgcattactcgtaatgggtcatcgcattaataaacttgtaattaaccgctgccgtaaa
cctgctgatgcggatattctcgtccctggcgatacaatttgtgtgattggtacaacgtca
agtcgtgttccttatgatcaaatcgataacatgcaagttacgccagaagaagtggatatt
cttttccgtgaaggtgaaaaactcgcacctagcttgcgtcatactcgcgtattacgtgct
tatgctggggtgcgaccattagttgcaagcgatgatgatccatcaggtcgtaatgtgagc
cgtggtattgtgctacttgaccacgcagaacgtgatggcttagatggctttattactatc
actggcggtaagttaatgacttatcgtttaatggctgaatgggcgactgaccttgtttgt
aaaaaactcaataaaacggctcgttgtgttactgctgaacaggctctaccaggttcgact
gaaagccgccaagagaccaatcaaaaagttatttcattaccaagtactattcgttattct
gccgtatatcgtcacggttcacgggctactcgtttgcttgaaaaagaacgtctagatcgt
tcaatggtttgcgaatgtgaagcggtaacagctggggaagttcgttacgctgttgatgaa
ctggatgtaaataatctcgtcgatttacgtcgtcgttcccgagttggaatgggaacttgt
caagctgaactctgtgcttgtcgtgctgcaggattaataaatcgttttgaagtggcaaca
ccacgtcaatcaactactcaactttccgcctttatggaagaacgctggcgtggtattgaa
ccgattgcttggggggaagctattcgcgaagccgaatttacctcttggatgtatgctagt
gtattaggtttaaatgatgtgaaaccgcttgatgaacaagcacaacaagggacggatagc
aatgaattttga

DBGET integrated database retrieval system