KEGG   Haemophilus influenzae F3047 (nontypeable): HICON_09500Help
Entry
HICON_09500       CDS       T01400                                 

Definition
(GenBank) ribose 5-phosphate isomerase A
  KO
K01807  ribose 5-phosphate isomerase A [EC:5.3.1.6]
Organism
hil  Haemophilus influenzae F3047 (nontypeable)
Pathway
hil00030  Pentose phosphate pathway
hil01100  Metabolic pathways
hil01110  Biosynthesis of secondary metabolites
hil01120  Microbial metabolism in diverse environments
hil01130  Biosynthesis of antibiotics
hil01200  Carbon metabolism
hil01230  Biosynthesis of amino acids
Module
hil_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
hil_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:hil00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    HICON_09500
Enzymes [BR:hil01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     HICON_09500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rib_5-P_isom_A DeoRC Sugar-bind RNase_PH_C
Motif
Other DBs
NCBI-ProteinID: CBY86415
LinkDB All DBs
Structure
PDB: 

Position
complement(740639..741298)
Genome map
AA seq 219 aa AA seqDB search
MNQLEMKKLAAQAALQYVKADTIVGVGSGSTVNCFIEALGTIKDKIQGAVAASKASEELL
RKQGIEVFNANDVSSLDIYVDGADEINPQKMMIKGGGAALTREKIVAALAKKFICIVDSS
KQVDVLGSTFPLPVEVIPMARSQVGRKLAALGGSPEYREGVVTDNGNVILDVHNFSILNP
VEMEKELNNVAGVVNNGIFALRGADVVIVGTPEGAKVID
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaattagaaatgaaaaaactcgccgcacaagctgcattacaatatgtaaaagca
gatacgattgttggggtgggaagtggctccacggtgaactgctttattgaggctttgggt
acaatcaaagataaaattcaaggtgccgttgcggcttcaaaagcatcagaagaattatta
cgtaagcaaggtatcgaagtatttaatgcaaatgatgtctctagcttagatatttatgtg
gatggtgcggatgaaatcaatccacaaaaaatgatgattaaaggcggcggcgcagcactc
actcgtgaaaaaatagtcgctgcattagcgaaaaaatttatttgtattgtggattcaagt
aagcaagtggatgtcttgggttcaactttcccattaccagttgaagtgattcctatggca
cgctcacaagtaggcagaaaattagccgcacttggtggctcacctgaatatcgtgaaggc
gtggtgacagacaacggcaatgtgattttagatgtgcacaacttcagtattttaaatcca
gtcgaaatggaaaaagaattaaataatgttgcaggtgtcgtcaataatgggatattcgcg
ttacgtggcgcagatgttgtgatcgtcgggacgcctgagggtgccaaagttattgactaa

DBGET integrated database retrieval system