KEGG   Haemophilus influenzae Rd KW20 (serotype d): HI1023Help
Entry
HI1023            CDS       T00001                                 

Gene name
tktA
Definition
(RefSeq) transketolase
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
hin  Haemophilus influenzae Rd KW20 (serotype d)
Pathway
hin00030  Pentose phosphate pathway
hin01100  Metabolic pathways
hin01110  Biosynthesis of secondary metabolites
hin01120  Microbial metabolism in diverse environments
hin01130  Biosynthesis of antibiotics
hin01200  Carbon metabolism
hin01230  Biosynthesis of amino acids
Module
hin_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:hin00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    HI1023 (tktA)
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    HI1023 (tktA)
Enzymes [BR:hin01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     HI1023 (tktA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transketolase_N Transket_pyr Transketolase_C DXP_synthase_N E1_dh TPP_enzyme_C
Motif
Other DBs
NCBI-GeneID: 949889
NCBI-ProteinID: NP_439183
UniProt: P43757
LinkDB All DBs
Position
complement(1087262..1089259)
Genome map
AA seq 665 aa AA seqDB search
MATRRQLANAIRVLAMDSVQKAKSGHPGAPMGMADIAEVLWRDFLKHNPTNPKWADRDRF
VLSNGHGSMLIYSLLHLTGYDLSIEDLKQFRQLHSKTPGHPEYGYAPGVETTTGPLGQGI
TNAVGMAIAEKTLAGQFNREGHEIVDHHTYVFLGDGCLMEGISHEACSLAGTLGLGKLIA
FYDDNNISIDGHVDGWFSDDTAERFEAYGWQVIRNVDGHDAEQIRAATILAQAEKGKPTL
IICKTIIGFGSPNKSGSHDSHGAPLGDEEIDLTRKALGWEYAPFEIPAEYYAEWSAKEKG
AAAEKSWEEKFAAYAKAYPELAAEFKRRVSGELPTNWAAESKAFIEKLQANPASIASRKA
SQNAIEAYAHVLPEFLGGSADLASSNLTLWSGSKPIRAHENVGGNYINYGVREFGMSAIM
NGIALHGGFIPYGATFLMFYEYAHNAVRMAALMKQRTLFVYTHDSIGLGEDGPTHQPVEQ
TASLRLIPNLETWRPCDQVESAIAWQQAVERQDGPSALIFTRQNLAQMDRTSAQLDAVKR
GAYVLKDCDGTPELIFIATGSEVELAVQAAEALSAEGKKVRVVSMPSTNRFDKQDAAYRE
SVLPAAVTKRVAIEAGIADFWYKYVGFNGRVIGMNSFGESAPADQLFKLFGFTVENVVAK
AKEIL
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atggcaactcgtagacaattagccaatgcaattcgtgtcttagcaatggattctgtacaa
aaagcgaaatctggtcaccctggtgcaccaatggggatggcggatattgctgaagtatta
tggcgcgactttttaaaacacaatccaaccaatcctaaatgggctgatcgagatcgtttt
gtactttctaacggccatggttctatgttgatttatagtcttttacatttaactggctat
gatctttctatcgaagatttaaaacaattccgtcaattacattctaaaaccccaggtcac
ccagaatatggttatgcccctggtgttgaaaccacgactggcccgttaggtcaaggtatc
actaatgcggtgggtatggcaattgctgagaaaaccttagctggacaatttaaccgtgaa
ggccatgaaattgtcgatcaccacacttatgtgttcttaggcgatggttgtttaatggaa
gggatttctcacgaggcttgctctttagcaggaaccttaggtctgggtaaattaatcgca
ttctacgatgacaacaatatttccattgatggtcatgttgatggctggttcagtgatgac
actgccgagcgttttgaagcttatggctggcaagtaatccgtaatgtagatggtcacgat
gcagagcaaattcgtgctgctaccattcttgctcaagcagaaaaaggaaaaccaacgtta
attatttgtaaaaccatcatcggctttggttcaccaaataaatcaggttctcatgattcc
catggcgcaccattaggcgatgaagaaatcgatttaacccgtaaagcacttggttgggaa
tatgcgccatttgaaattccagctgaatactatgctgaatggtcggcaaaagagaaaggt
gctgcagcagaaaaatcttgggaagaaaaatttgccgcttatgcaaaagcctatcctgaa
ttagcagcagaatttaaacgtcgtgtttctggcgaattaccaacaaactgggcggcagaa
tctaaagcgttcatcgaaaaattacaagcaaatccagcgagtattgcaagccgtaaagca
tcacaaaatgctatcgaagcttatgcgcacgtattacctgaattcttaggtggctctgca
gacttagcaagctctaacttaacgttatggagtggttctaaaccaattcgtgcccacgaa
aacgtaggtggtaactacattaactacggcgttcgtgaatttggtatgtctgccattatg
aacggtattgctttacacggcggtttcattccttacggcgcaaccttcttaatgttctac
gaatatgctcacaatgcggtgcgtatggcagcattaatgaaacaacgcacattattcgtt
tatacccacgattccattggtttaggcgaagatgggcctacacaccaaccagtagaacaa
acggcttcactacgcttaattccaaaccttgaaacatggcgtccatgtgaccaagttgaa
tcagccatcgcatggcaacaagcggttgaacgtcaagatggcccaagtgcgttgatcttt
acccgtcaaaacttagcccaaatggaccgcacttctgcacaattagatgcggttaaacgt
ggtgcttatgtgttaaaagactgtgatggcacacctgagttaatcttcattgcgacaggt
tctgaagtggaattagcagtgcaagcagccgaagcattaagtgctgaaggtaaaaaagta
cgcgttgtttctatgccaagtactaaccgtttcgataaacaagatgcagcgtaccgtgaa
agtgtattacctgcagcggtaaccaaacgtgttgcgattgaagcgggtattgctgacttc
tggtataaatacgttggattcaatggtcgtgttatcggtatgaatagctttggcgaatcc
gcaccagcagatcaattattcaaactctttggtttcactgttgaaaacgtggtagcaaaa
gcgaaagaaattctttaa

DBGET integrated database retrieval system