KEGG   Haemophilus influenzae Rd KW20 (serotype d): HI1062Help
Entry
HI1062            CDS       T00001                                 

Gene name
fabZ
Definition
(RefSeq) (3R)-hydroxymyristoyl-ACP dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
hin  Haemophilus influenzae Rd KW20 (serotype d)
Pathway
hin00061  Fatty acid biosynthesis
hin00780  Biotin metabolism
hin01100  Metabolic pathways
hin01212  Fatty acid metabolism
Module
hin_M00083  Fatty acid biosynthesis, elongation
hin_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:hin00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    HI1062 (fabZ)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    HI1062 (fabZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:hin01004]
    HI1062 (fabZ)
Enzymes [BR:hin01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     HI1062 (fabZ)
Lipid biosynthesis proteins [BR:hin01004]
 Fatty acid synthase
  Component type
   HI1062 (fabZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA MaoC_dehydratas PS-DH
Motif
Other DBs
NCBI-GeneID: 950037
NCBI-ProteinID: NP_439220
UniProt: P45012
LinkDB All DBs
Position
complement(1126891..1127337)
Genome map
AA seq 148 aa AA seqDB search
MSEQQPKVIESKEIMTLLPHRYPFLLVDRVLDFKEGEWLKAIKNISVNEPCFTGHFPGEP
ILPGVLILEALAQAMGILAFKTHELKGGELFYFAGIDEARFKRPVLPGDQMELNVQVIKK
RRGITAFTGVATVNGEIACEAKLMCARR
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
gtgtcagaacaacaaccaaaagtgatcgaatcaaaagaaattatgactttattaccacat
cgctatccatttttattagtggatcgcgtattggattttaaagaaggcgaatggttaaaa
gcgattaaaaatatcagcgtcaatgagccttgtttcacaggccacttcccaggcgaaccc
attttaccgggcgttttaattttagaagctttggcacaagcaatgggcattttagccttt
aaaactcacgaattaaaaggcggcgaactattctactttgcaggtattgatgaagcgcgc
tttaaacgcccagtattaccgggagatcaaatggaattaaacgttcaagtgattaaaaaa
cgccgtggtattactgcatttactggcgttgccaccgtaaacggcgaaatcgcttgtgaa
gcaaaactaatgtgtgctcgtcgttaa

DBGET integrated database retrieval system