KEGG   Haemophilus influenzae Rd KW20 (serotype d): HI1733Help
Entry
HI1733            CDS       T00001                                 

Gene name
rnb
Definition
(RefSeq) exoribonuclease II
  KO
K01147  exoribonuclease II [EC:3.1.13.1]
Organism
hin  Haemophilus influenzae Rd KW20 (serotype d)
Brite
KEGG Orthology (KO) [BR:hin00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:hin03016]
    HI1733 (rnb)
Enzymes [BR:hin01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.1  exoribonuclease II
     HI1733 (rnb)
Transfer RNA biogenesis [BR:hin03016]
 Prokaryotic type
  3'processing and CCA adding factors
   3'processing factors
    HI1733 (rnb)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNB S1 OB_RNB CSD2 DUF2274 TRAM
Motif
Other DBs
NCBI-GeneID: 950879
NCBI-ProteinID: NP_439875
UniProt: P44440
LinkDB All DBs
Position
complement(1809215..1811194)
Genome map
AA seq 659 aa AA seqDB search
MFQDNPLLAQLKQQIHDSKEQVEGVVKSTDKAYGFLECDKKTYFIAPPSMKKVMHGDKIK
ATIEKQGDKEQAEPEALIEPMLTRFIAKVRFNKDKKLQVLVDHPSINQPIGAQQAKSVKE
ELQEGDWVVANLKTHPLRDDRFFYATINQLICRADDELAPWWVTLARHEQSRYPVRGAEP
YEMLDQKTRENLTALHFVTIDSESTMDMDDALYIEPIAQNSTQTGWKLVVAIADPTAYIA
LDSQIEQEAKQRCFTNYLPGFNIPMLPRELSDELCSLIANETRPALVCYIETDLTGNITA
KPHFVSAYVQSKAKLAYNKVSDYLEQADNAWQPEMPETAQQIHWLHQFTKARIQWRKTHS
LFFKEKPDYAFVLAENGKVQEIKAEYRRIANQIVEEAMIIANICAAQFLHEQAKTGIFNT
HSGFDKKFLENAHNFLMANLANEQNQTELAERYSVENLATLNGYCQMRHDIEPIESDYLE
LRLRRYLTFAEFKSELAPHFGLGLEGYATWTSPIRKYSDMVNHRLIKAVLAKQPYEKPQN
DVLARLQEARRQNRLVERDIADWLYCRYLADKVASNAEFEAEVQDVMRAGLRVQLLENGA
SLFIPAATLHNNKEEIQLNPDELALYIKGERTYKIGDMVKVKLTEVKEATRSIVGEILQ
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
atgtttcaagataatcctctactcgcacaacttaaacaacaaatccacgacagcaaagaa
caggttgagggcgtggtaaaaagcacagataaagcctacggttttttagagtgcgataaa
aaaacctatttcatcgcaccgccatcaatgaaaaaagtgatgcatggcgacaaaatcaaa
gccactattgaaaaacaaggcgacaaagaacaagccgagccagaagccttaattgagcca
atgctcacacgttttatcgcaaaagtgcggttcaataaagacaagaaattacaagtgctg
gtggatcacccaagtattaatcaacccattggcgcacaacaggcgaaatcggtaaaagaa
gaattgcaagagggcgactgggtcgtcgcaaatttaaaaacccatccattacgtgacgat
cgctttttctacgccacaattaatcaacttatttgccgagctgacgatgaattagcccct
tggtgggtcacattggcacgccacgaacaatcgcgctatcccgtgcgaggcgcagaacct
tatgaaatgttagatcaaaaaacacgcgaaaatctgaccgcacttcattttgtaaccatt
gattccgaaagcacaatggatatggacgacgccttatatatcgaacccatagcacaaaac
agcacacaaacaggctggaaattagtggtcgccattgctgacccaaccgcttacatcgcc
ttagattctcaaatagaacaagaagccaaacagcgttgcttcacaaattatttaccgggc
tttaacattccaatgttaccccgtgaattatctgatgaattatgttccttaatcgccaat
gaaacccgccccgcgcttgtctgttatatcgaaaccgatcttacaggcaacatcacagcc
aaaccgcattttgtttccgcttatgttcaatctaaagccaaactggcttacaacaaagtg
tcggattatttagaacaggcagacaatgcatggcagccagaaatgccagaaacagcacaa
caaattcactggctacatcaatttaccaaagctcgcattcaatggcgcaaaacccattcc
ttattctttaaagaaaaacccgattatgcctttgtgctggcagaaaacggcaaagtacaa
gaaatcaaagcagaatatcgccgtattgccaatcaaattgtggaagaagcaatgattatt
gccaacatctgcgccgcccaatttttacacgaacaggcaaaaacaggcattttcaacacc
catagcggttttgataaaaaattcttagagaacgcacacaatttcttaatggcaaattta
gccaatgaacaaaatcaaactgaactggcagaacgttattcagtagaaaacttagcaacc
ttaaacggctattgccaaatgcgccacgatattgaacccatcgaaagcgattatttagaa
ctgcgtttacgccgttatttaactttcgccgaatttaaatcagaattagcaccgcacttt
gggctggggctagagggttacgccacttggacatcgcccatccgcaaatattcagatatg
gttaatcatcgcttaatcaaagccgtgctggcaaaacagccttatgaaaaaccacaaaat
gacgtgttggcacgtttgcaagaggctcgccgccaaaatcgcctcgtagaacgtgatatt
gccgattggctatattgccgttatcttgctgacaaagtggcatcaaatgctgaatttgag
gcggaagtgcaagatgtaatgcgtgcaggcttacgcgtacaactgctcgaaaatggtgca
tcgctatttattcctgccgccacgctgcacaacaacaaagaagaaatacaactaaaccct
gacgaacttgccctctatataaaaggcgaacgcacttacaaaataggcgacatggtaaaa
gtgaaactcacagaagtgaaagaagccacacgcagtattgtgggcgaaatacttcaataa

DBGET integrated database retrieval system