KEGG   Haemophilus influenzae PittEE (nontypeable): CGSHiEE_03040Help
Entry
CGSHiEE_03040     CDS       T00543                                 

Definition
(GenBank) zinc-type alcohol dehydrogenase
  KO
K21395  TRAP-type transport system periplasmic protein
Organism
hip  Haemophilus influenzae PittEE (nontypeable)
Brite
KEGG Orthology (KO) [BR:hip00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hip02000]
    CGSHiEE_03040
Transporters [BR:hip02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   CGSHiEE_03040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DctP ADH_N ADH_zinc_N AlaDh_PNT_C Glu_dehyd_C DAO HI0933_like Pyr_redox Pyr_redox_2 FAD_binding_2 FAD_binding_3 Pyr_redox_3 NADH_4Fe-4S DUF743 NAD_binding_8 FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: ABQ98038
LinkDB All DBs
Structure
PDB: 

Position
612633..614675
Genome map
AA seq 680 aa AA seqDB search
MKERIKAICLEKPNNVVVKEVPYPEKSDNDVLIQVESMGICGSDIGAYRGTNPLVTYPRI
LGHEIVGRVIESGIGMSDGVRVGERVIVDPYVFCGQCYPCSIGRTNCCESLKVIGVHIDG
GMQEVIRHPAHLLTKVPDNLPIHQLPLAEPLTIALHALHRTTLKSGEHIVIIGAGAIGLM
AALAAVQYGAIPILVDILEQRLEYAKSLGIEHIVNPHKEDDIKRIKEITSGRMAEVVMEA
SGVNISIKNTLHYASFAGRIALTGWPKTETPLPTNLITFKELNIYGSRTSKGEFEEALDM
LATNKINASYIITKCIKFEEIPSFISDLSDHPENYLKINAVLLKNIINKEKVMKSIKGLG
KLLLASSILFSSSAFAKTIIKLGHYNSDIHPSHIALQEYFKKTIENETNHKYEIRLYPNN
QLGGEDQIVNGLRNGTIEAGITGLLLQNVDPIFGVWEWPYLFKDNQEAKKVLESPIANKI
GQKMEKYGIKLLAYGMNGFRVISSNKKLEKFDDFKGLRLRVPLNSLFVDRAKAMNINPQS
MPLSEVFTALEQKVIDGQENPYMLIKDSGLYEVQKYIIQSNHIFSPGLLQISLKTWNKIP
KEDQIIFEKAAKLYQEKEWELAIKTELEVKDYLAKHGNEIIVPSEAFKNDMVNASKVLYD
SFYKKYDWAKDVVQKINEAK
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
atgaaggagcgaatcaaagcaatatgtttagaaaaaccaaacaatgtagttgttaaagaa
gtgccttatcccgagaaaagtgataatgatgtacttattcaggtagaatcaatggggatt
tgtggttctgatattggtgcatatagaggaactaatccattagtaacttatccaagaata
cttgggcatgaaattgtagggagagtaattgaaagtggaattggtatgtcagatggggta
agggttggagagcgagtaattgttgatccttatgttttctgtggtcaatgctatccttgt
tcaattggtagaaccaattgttgtgaatcattaaaggtaattggtgttcatattgatgga
ggtatgcaggaggtaattagacatcccgctcatcttttaactaaagtcccagataaccta
ccgattcatcaattacctttagctgaacctttaacaatagctttacacgctttacataga
acaactttaaaatcaggggaacacatagtaattattggagctggtgcaattggattaatg
gctgcattagcagcggttcaatatggagcaatcccaattttagttgatatattagaacaa
cgtcttgagtatgcaaaatccttgggaattgaacatattgtaaatccgcataaggaggat
gacattaaaagaattaaggaaattacaagtggtcgtatggctgaagttgttatggaggca
tctggtgttaatatttctatcaaaaatactctgcattatgcctcctttgcaggaagaatt
gctttaacaggatggccaaaaacagaaactccattaccaacaaatttaattacctttaaa
gaattgaatatttatggttctagaacaagcaagggggaatttgaggaggcattggatatg
cttgctactaataaaattaatgcatcttatatcattactaagtgtatcaaatttgaagaa
attcctagttttatttctgatttatctgatcatccagaaaattatttaaaaattaatgca
gttttactaaaaaacataatcaataaggagaaagttatgaagtcaattaaaggcttaggt
aaattattacttgcttcaagtatattgtttagtagcagtgcatttgcaaaaacaattatt
aagttaggacattataattctgatattcatccatcacatattgcattacaggaatatttt
aagaaaacaattgaaaatgaaacaaatcataaatatgagattagactttatcctaataat
caacttggcggtgaagatcaaattgtaaatggattacgtaatggcactatagaagcaggt
attacaggtttattattgcaaaatgtagatcctatttttggagtttgggaatggccttat
ttatttaaggataatcaagaggctaaaaaagtattggaatctccaatcgcaaataaaatt
ggtcaaaaaatggagaagtatggaattaaattacttgcctatggtatgaatggatttcgt
gttatttcatctaataaaaaattagagaaatttgacgattttaaaggtttacgtttaaga
gttccgctgaattcactttttgttgatagggctaaagcaatgaatataaatccacaaagc
atgccactcagtgaagtttttactgcattagaacaaaaggtaattgatggtcaagaaaat
ccgtatatgttaattaaagactctgggttatatgaagtacaaaaatatattatccaaagt
aaccatattttctctccaggattattacaaattagcttaaaaacttggaataaaattcca
aaagaagatcaaattatttttgaaaaagcagctaaattgtatcaagagaaagagtgggaa
ttagcaattaaaacagaattagaagttaaagattatctagctaaacatggaaatgaaatt
atcgtaccaagtgaagcatttaaaaatgacatggtgaatgcatctaaggtgctttatgat
agtttttataaaaaatatgattgggctaaggatgtagtccaaaaaattaacgaagctaaa
taa

DBGET integrated database retrieval system