KEGG   Haemophilus influenzae PittEE (nontypeable): CGSHiEE_05315Help
Entry
CGSHiEE_05315     CDS       T00543                                 

Definition
(GenBank) phospho-2-dehydro-3-heoxyheptonate aldolase
  KO
K01626  3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
hip  Haemophilus influenzae PittEE (nontypeable)
Pathway
hip00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hip01100  Metabolic pathways
hip01110  Biosynthesis of secondary metabolites
hip01130  Biosynthesis of antibiotics
hip01230  Biosynthesis of amino acids
hip02024  Quorum sensing
Module
hip_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:hip00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CGSHiEE_05315
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    CGSHiEE_05315
Enzymes [BR:hip01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     CGSHiEE_05315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAHP_synth_1
Motif
Other DBs
NCBI-ProteinID: ABQ98439
LinkDB All DBs
Position
complement(1066899..1067987)
Genome map
AA seq 362 aa AA seqDB search
MAKEKIEIVVANDDTRIEKVDQVLPPIALLEKYPASEQAAALVKQTRHEAHNIIHGKDDR
LLVVIGPCSIHDPKVAIEYATRLKPLREKYKDSLEIIMRVYFEKPRTTVGWKGLINDPYL
NDTYRLNDGLRIARKLLSDINDLGVPAAGEFLDMITPQYLADFMSWGAIGARTTESQVHR
ELASGLSCAVGFKNATNGGVKVALDAIGAAEAPHYFLSVTKFGHSAIVSTKGNEDCHIIL
RGGDKGPNYSAEDVEKVCADIEKTGRIPHVMVDFSHANSSKQYKKQMDVCQDVCNQIAFG
SKQIFGVMVESHLVEGRQDLVDGKAQTYGQSITDACIGWEDSERLLQQLSDAVIARRKAT
SN
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagagaaaattgaaattgtcgtggcgaacgacgatacgagaattgaaaaagtt
gatcaggtattaccaccgattgcattattagaaaaatatccagctagtgaacaggctgcg
gcattagtgaagcaaactcgtcatgaggcacataatattattcatggtaaagatgatcgt
ttattagtcgtgattgggccttgctctattcatgatccgaaagttgccattgaatatgcg
actcgtttaaaaccattacgtgaaaaatacaaagatagccttgaaattattatgcgtgtg
tattttgagaaaccgcgtacaacggtgggttggaaaggtttaattaatgatccatatttg
aatgatacttatcgtttaaatgatgggttgcgtattgcacggaaattactttcagatatt
aatgatcttggtgtgcctgcagcgggcgagtttttagatatgattacacctcagtatttg
gcagattttatgagctggggggcgattggggctagaacaacagaatcacaagttcatcgt
gagttggcttcaggtttatcttgtgctgttgggtttaaaaatgccactaatggtggtgtg
aaagtcgctttagatgcaattggagcggcggaagctccccactatttcttatctgtcact
aaatttggtcattctgcaattgtttctacaaaagggaatgaagattgccatattatttta
cgaggtggagataaaggccctaactatagtgctgaagatgtagaaaaagtttgtgctgat
attgaaaaaacagggcgtattccacacgttatggttgattttagccatgcaaacagcagt
aaacaatataaaaagcaaatggatgtttgccaagacgtatgcaatcagattgcatttggt
tctaaacaaatctttggcgtaatggtggaaagccatttagtggaaggtcgtcaagattta
gttgatggcaaagcacagacttatggacaaagtattacggatgcgtgcattggatgggaa
gattctgaaagattattgcaacaactttctgatgcagttattgctagacgtaaagcgacg
agtaattaa

DBGET integrated database retrieval system