KEGG   Haemophilus influenzae PittEE (nontypeable): CGSHiEE_08755Help
Entry
CGSHiEE_08755     CDS       T00543                                 

Gene name
glpA
Definition
(GenBank) sn-glycerol-3-phosphate dehydrogenase subunit A
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
hip  Haemophilus influenzae PittEE (nontypeable)
Pathway
hip00564  Glycerophospholipid metabolism
hip01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hip00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    CGSHiEE_08755 (glpA)
Enzymes [BR:hip01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     CGSHiEE_08755 (glpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO FAD_binding_2 Fer2_BFD FAD_binding_3 DAO_C FAD_oxidored NAD_binding_8 Thi4 Pyr_redox_2 3HCDH_N HI0933_like Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: ABQ99048
LinkDB All DBs
Position
1732092..1733783
Genome map
AA seq 563 aa AA seqDB search
MGLSPSIYKDVGDLSPLSTDVIIIGGGATGAGIARDCALRGIDCILLERRDIATGATGRN
HGLLHSGARYAVNDQESAEECIKENRILRKIARHCVDETEGLFITLPEDSLDYQKTFLES
CAKSGIDAQAIDPELAKIMEPSVNPDLVGAVVVPDGSIDPFRLTASNMMDATENGAKMFT
YCEVKNLIREGGKVIGVNVYDHKNRRERQFFAPLVVNAGGIWGQGIAEYADLKIKMFPAK
GALLVMGHRINKLVINRCRKPADADILVPGDTICVIGTTSSRIPYDQIDNMEVTPEEVDI
LFREGEKLAPSLRHTRVLRAYAGVRPLVASDDDPSGRNVSRGIVLLDHAERDGLDGFITI
TGGKLMTYRLMAEWATDLVCKKLNKTARCVTAEQALPGSTESRQETNQKVISLPSTIRYS
AVYRHGSRATRLLEKERLDRSMVCECEAVTAGEVRYAVDELDVNNLVDLRRRSRVGMGTC
QAELCACRAAGLMNRFEVATPRQSTTQLSAFMEERWRGIEPIAWGEAIREAEFTSWMYGS
VLGLNDVKPLDEQAQQGTDSNEF
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgggattatcgcctagtatctataaagatgttggagatctttcgccacttagcactgat
gtgatcattatcggtggtggtgcaacaggagcaggtattgcgcgcgattgcgcacttcgt
ggcattgattgtattttattggaacgtcgagatattgcgacaggtgccacaggacgtaac
cacggattattacacagtggtgcgcgttatgccgtgaacgaccaagaatctgctgaagaa
tgtattaaagaaaaccgcattttgcgcaaaattgcgcgtcattgcgtagatgaaacggaa
ggcttatttatcactttgcctgaagattctctcgactatcaaaaaactttccttgagagc
tgtgcaaaatctggaattgatgcgcaagccattgatcctgaactagctaaaattatggag
ccttcagtaaaccctgatttagtgggtgctgttgttgtgccagatggttctattgaccca
ttccgtttaaccgcctctaatatgatggatgcgacagaaaatggtgcaaaaatgttcact
tattgcgaagtaaaaaatttgattcgtgaaggtggaaaagtgattggtgtgaatgtgtac
gatcacaaaaatcgtagagaacgccaattttttgcaccgcttgttgtgaatgctggtggt
atttgggggcaagggattgcggaatatgccgatctcaaaatcaaaatgttccctgcaaaa
ggcgcattgctcgtaatgggccatcgcattaataaacttgtcattaaccgctgccgtaaa
cctgctgatgcggatattctcgtacctggcgatacaatttgtgttatcggaacaacatct
agccgcattccttatgatcaaattgataatatggaagtaacgccagaggaagtggatatt
cttttccgtgagggagaaaaacttgcaccgagcttacgtcatactcgcgtattacgtgct
tatgctggggtgcgaccattagttgcgagtgatgatgatccatcaggtcgaaatgtgagt
cgtggtattgtactacttgaccacgcagagcgtgatggcttagatggctttattacaatc
actggcggtaagttaatgacttatcgtttaatggctgaatgggcgactgaccttgtttgt
aaaaaactcaataaaacggctcgttgtgttactgctgaacaggctctaccaggttcgact
gaaagtcgccaagagaccaatcaaaaagttatttcattaccaagtactattcgttattct
gctgtgtatcgtcatggttcacgtgctactcgtttgcttgaaaaagaacgtttagatcgt
tcaatggtttgtgaatgcgaagcggtgacggcgggggaagttcgttacgctgttgatgaa
ctggatgtaaataatctcgtcgatttacgtcgtcgctcccgagttggaatgggaacttgt
caagctgaactctgtgcttgtcgtgctgcaggactaatgaatcgttttgaagtggcaaca
ccacgtcaatcaactactcaactttctgcttttatggaagaacgctggcgcggtattgag
ccgattgcttggggtgaagctattcgcgaagccgaatttacctcttggatgtatggtagc
gtattaggtttaaatgatgtgaaaccgcttgatgaacaagcacaacaagggacggatagc
aatgaattttga

DBGET integrated database retrieval system