KEGG   Haemophilus influenzae PittGG (nontypeable): CGSHiGG_06725Help
Entry
CGSHiGG_06725     CDS       T00544                                 

Definition
(GenBank) anaerobic glycerol-3-phosphate dehydrogenase subunit A
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
hiq  Haemophilus influenzae PittGG (nontypeable)
Pathway
hiq00564  Glycerophospholipid metabolism
hiq01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hiq00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    CGSHiGG_06725
Enzymes [BR:hiq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     CGSHiGG_06725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO FAD_binding_2 Fer2_BFD DAO_C FAD_binding_3 FAD_oxidored Thi4 NAD_binding_8 Pyr_redox_2 3HCDH_N HI0933_like Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: ABR00229
UniProt: A5UHH3
LinkDB All DBs
Position
complement(1224211..1225902)
Genome map
AA seq 563 aa AA seqDB search
MGLSPSIYKDVGDLSSLSTDVIIIGGGATGAGIARDCALRGIDCILLERRDIATGATGRN
HGLLHSGARYAVNDQESAEECIKENRILRKIARHCVDETEGLFITLPEDSLDYQKTFLES
CAKSGIDAQAIDPELAKIMEPSVNPDLVGAVVVPDGSIDPFRLTASNMMDATENGAKMFT
YCEVKNLIREGGKVIGVNVYDHKNRRERQFFAPLVVNASGIWGQGIAEYADLKIKMFPAK
GALLVMGHRINKLVINRCRKPADADILVPGDTICVIGTTSSRIPYDQIDNMEVTPEEVDI
LFREGEKLAPSLRHTRVLRAYAGVRPLVASDDDPSGRNVSRGIVLLDHAERDGLDGFITI
TGGKLMTYRLMAEWATDLVCKKLNKTARCVTAEQPLPGSTESRQETNQKVISLPSTIRYS
AVYRHGSRATRLLEKERLDRSMVCECEAVTAGEVRYAVDELDVNNLVDLRRRSRVGMGTC
QAELCACRAAGLMNRFEVATPRQSTTQLSAFMEERWRGIEPIAWGEAIREAEFTSWMYGS
VLGLNDVKPLDEQAQQGTDSNEF
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgggattatcgcctagtatctataaagatgttggagatctttcgtcacttagcactgat
gtgatcattatcggtggtggcgcaacaggagcaggtattgcgcgcgattgcgcacttcgt
ggcattgattgtattttattggaacgtcgagatattgcgacaggagccacaggacgtaac
cacggattattacacagtggtgcgcgttacgccgtgaacgaccaagaatctgctgaagaa
tgtattaaagaaaaccgcattttgcgcaaaattgcacgtcattgcgtagatgaaacggaa
ggcttatttatcactttgcctgaagattcgctcgactatcaaaaaaccttccttgagagc
tgtgcaaaatctggaattgatgcgcaagccattgatcctgaactagctaaaattatggaa
ccttcagtaaaccctgatttagtgggcgctgttgttgtgccagatggttctattgaccca
ttccgtttaaccgcctctaatatgatggacgccacagaaaacggcgcaaaaatgttcact
tattgcgaagtaaaaaatttgattcgtgaaggtggaaaagtgattggcgtaaatgtgtac
gatcacaaaaatcgcagagaacgccaattttttgcaccgcttgttgtaaatgctagtggt
atttggggacaagggattgcggaatatgccgatctcaaaattaaaatgttccctgcaaaa
ggcgcattgctcgtaatgggccatcgcattaataaacttgtcattaaccgctgccgtaaa
cctgctgatgcggatattctcgtacctggcgatacaatttgtgttataggaacaacatct
agccgcattccttatgatcaaattgataatatggaagtaacgccagaggaagtggatatt
cttttccgtgagggagaaaaacttgcgcctagtttgcgtcatacacgtgtattacgtgct
tacgctggggtgcgaccattagttgcgagtgatgatgatccatcaggtcgtaatgtgagc
cgtggtattgtgttacttgaccacgcagaacgtgatgggttagatggctttattacaatc
actggcggtaagttaatgacttatcgtttaatggctgaatgggcgaccgaccttgtttgt
aaaaaactcaataaaacagctcgttgtgtaactgcggagcaacctttgcctggctctact
gaaagccgtcaagagaccaatcaaaaagtcatttcattaccaagtactattcgttattct
gctgtgtatcgtcatggttcacgtgctactcgtttgcttgaaaaagaacgtttagatcgt
tcaatggtttgcgaatgcgaagcggtgacagcaggggaagttcgttacgctgttgatgaa
ctggatgtaaataatctcgttgatttacgtcgtcgttcccgagttggaatgggaacttgt
caagctgaactctgtgcttgtcgtgctgcaggactaatgaatcgttttgaagtggcaaca
ccacgtcaatcaactactcaactttctgcttttatggaagaacgctggcgcggtattgag
ccgattgcttggggggaagctattcgcgaagccgaatttacatcttggatgtatggtagc
gtattaggtttaaatgatgtgaaaccgcttgatgaacaagcacaacaagggacggatagc
aatgaattttga

DBGET integrated database retrieval system