KEGG   Haemophilus influenzae PittGG (nontypeable): CGSHiGG_07970Help
Entry
CGSHiGG_07970     CDS       T00544                                 

Definition
(GenBank) aerobic respiration control protein ArcA
  KO
K07773  two-component system, OmpR family, aerobic respiration control protein ArcA
Organism
hiq  Haemophilus influenzae PittGG (nontypeable)
Pathway
hiq02020  Two-component system
Brite
KEGG Orthology (KO) [BR:hiq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CGSHiGG_07970
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:hiq02022]
    CGSHiGG_07970
Two-component system [BR:hiq02022]
 OmpR family
  ArcB-ArcA (anoxic redox control)
   CGSHiGG_07970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C DUF3653
Motif
Other DBs
NCBI-ProteinID: ABR00434
UniProt: A5UI28
LinkDB All DBs
Position
complement(1467607..1468317)
Genome map
AA seq 236 aa AA seqDB search
MATPKILVVEDEIVTRNTLKGIFEAEGYDVFEAENGVEMHHILANHNINLVVMDINLPGK
NGLLLARELREELSLPLIFLTGRDNEVDKILGLEIGADDYLTKPFNPRELTIRARNLLHR
TMSHQEKENTFGREFYRFNGWKLDLNSHSLITPEGQEFKLPRSEFRAMLHFCENPGKLQT
REELLKKMTGRELKPQDRTVDVTIRRIRKHFEDHPNTPNIIMTIHGEGYRFCGDIE
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atggctactccaaaaattctcgttgttgaagatgaaattgtcactcgaaatacgcttaaa
gggatttttgaagcggaaggatatgatgtgtttgaagcagaaaatggtgttgaaatgcat
catatattggcaaatcataatattaatttggttgtgatggatattaatttaccaggtaaa
aacggcttattattggcaagagaactccgtgaagaattaagcttacctcttattttttta
actggtcgagataatgaagtggataaaattttaggtctggaaattggtgccgacgattat
ttaaccaaaccttttaaccctagagaactgactatccgcgcacgtaatctattgcatcgc
acaatgtcacatcaagaaaaagaaaatacatttggtcgagaattctatcgttttaatggt
tggaaattagacctaaatagccacagtttaattacaccagaaggacaagaattcaaactt
cctcgcagtgaatttcgtgcaatgttacatttctgtgaaaatccaggaaaattgcaaacg
cgcgaagaattgctcaaaaaaatgacgggacgagagttaaaacctcaggatcgtaccgta
gatgtcacaattcgacgtatcagaaaacattttgaagatcatccaaatactccaaatatc
attatgactatacatggagaaggctatcgtttttgcggagatattgaataa

DBGET integrated database retrieval system