KEGG   Heterobasidion irregulare: HETIRDRAFT_109324Help
Entry
HETIRDRAFT_109324 CDS       T03455                                 

Definition
(RefSeq) glycoside hydrolase family 31 protein
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
hir  Heterobasidion irregulare
Pathway
hir00052  Galactose metabolism
hir00500  Starch and sucrose metabolism
hir01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hir00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    HETIRDRAFT_109324
   00500 Starch and sucrose metabolism
    HETIRDRAFT_109324
Enzymes [BR:hir01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     HETIRDRAFT_109324
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31
Motif
Other DBs
NCBI-GeneID: 20666432
NCBI-ProteinID: XP_009541880
JGI: Hetan2_109324
UniProt: W4KGJ3
LinkDB All DBs
Position
Unknown
AA seq 398 aa AA seqDB search
MRGAGVPLEVMWNDIDLYHSLRDFISDPISYPPEEMRAFTRELAANGQHYIPIVDAAIGH
VANATDVYDPYTRGVEQDVFIKNPDGSIYIGQVWPGYTVFPDWFANGTEAWWADALRNWS
AAGVEYSGIWLDMNEASSFCDGYTNAKLALPQEGEPDPHKPCELGAVEDDKIKRKRWLDK
LLCVAELVQCRREVEVGGAFEAAVGLALIGIARGDQEREQGNSKETDGPCVGHAHALRRR
GGSRLDEAAETSTHIEEVLVTMLESALEAVVDAGSIAEGLVAVACAEFGLCDVERGRGVR
ELAIGKLDDELDGDVCGVDEALICNVDGTRERGLRGNGERAQRDVEAIDEGEGIVGSCEL
GGGRPAEVWIVGRAAAGEATAERDAVNESRLPFWELWA
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgcgcggggcgggggtgcctctcgaagttatgtggaacgatatagatctctaccattcg
ctgcgcgatttcatatctgaccctataagctatcccccggaggagatgcgtgcgttcacg
cgcgagttggctgcgaacggacagcactatatcccgatcgtagacgctgctatcggacac
gtcgcgaatgccactgatgtctacgacccgtacacacgaggagttgagcaggacgtgttc
attaagaacccagacgggtcaatatacatcggacaagtctggccggggtacactgtcttc
ccggactggttcgcaaacggcacagaggcgtggtgggccgatgcgctgcgtaactggagc
gcggcgggcgtcgagtactccggtatatggctcgacatgaacgaggcgagctcgttttgc
gacgggtatactaacgcaaagctcgcgttgccccaggagggcgaaccagacccacataag
ccgtgcgagctaggtgccgttgaggacgacaagatcaaacggaaacggtggctggacaag
ctcctatgtgtggccgagcttgtacagtgtaggcgcgaagttgaagtaggcggcgcgttc
gaggcagcggtaggcctcgccctcataggcatcgcccgcggggatcaagagcgtgaacag
gggaatagcaaggagacagatggcccatgcgtcggccatgcccatgcgctgcggaggaga
ggagggtcgaggttggacgaagccgcagagacaagtacgcacatagaggaagttctcgtc
accatgcttgagtccgcactcgaagcagtcgttgacgcgggcagcatcgccgaaggtctc
gtagccgtagcctgcgcggaatttggcctctgtgacgtagagagagggcggggtgtgcgg
gagctggcgattggcaagctagacgatgagctggatggcgacgtgtgcggggtggacgag
gctctgatctgcaatgttgacgggactcgggagcgggggctccgaggcaatggagagaga
gcgcaacgagatgtcgaggcgatcgacgagggagagggcatcgtgggctcatgcgagctc
ggaggcggccggccagcggaggtctggattgtggggagagcagcggcaggcgaggcgacg
gcagagagggacgcggttaacgagagcaggctgccgttctgggagctttgggcctag

DBGET integrated database retrieval system