KEGG   Heterobasidion irregulare: HETIRDRAFT_120354Help
Entry
HETIRDRAFT_120354 CDS       T03455                                 

Definition
(RefSeq) glycoside hydrolase family 15 protein
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
hir  Heterobasidion irregulare
Pathway
hir00500  Starch and sucrose metabolism
hir01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hir00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    HETIRDRAFT_120354
Enzymes [BR:hir01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     HETIRDRAFT_120354
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CBM_20
Motif
Other DBs
NCBI-GeneID: 20666690
NCBI-ProteinID: XP_009552639
JGI: Hetan2_120354
UniProt: W4JNY4
LinkDB All DBs
Position
Unknown
AA seq 234 aa AA seqDB search
MSDTRPHSTVDTCFAHHPPSDLQAPGDRSAPGSINFFQQFSSAITAGSHASSTSNCTTLT
AAIKTFTDAFVAELAKNTSPSGRRSGSPDNMVDLPRSFASAFAASDARGGVIAIHWGATD
LVVPSSSSTSSGASSGTVAVTFDVHATTVWGENIYITGSVGALKNWSPKNALLLSAAKYP
TWSITINLPANTPIQYKYIRKYKGATTWEKDPNKRITTPSGDTCIVKDSWRGRR
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacacccgtcctcactcgactgtggacacgtgttttgcacaccacccgccatcc
gatctgcaggcacccggagatcgctcggcacctgggagcatcaacttctttcagcagttc
tcctccgccattacggccggcagccacgcatcgtctacctctaattgcaccacacttact
gccgccatcaagaccttcaccgacgccttcgtcgcagagcttgcaaagaacacttcgcca
agcggtagaaggtctggctctccagacaacatggtggatctgcccaggagcttcgcaagc
gccttcgccgcatccgatgcgaggggtggcgtgatcgctatccactggggcgccacagat
ttggttgtcccgtcatcttcctcgaccagctctggagccagctctggcaccgttgccgtg
acgttcgacgttcatgcaaccacagtttggggagagaacatctatatcaccggctccgtc
ggtgctctgaaaaactggtctccgaagaacgccctccttctatcagcggcaaaatacccc
acctggagcatcaccatcaatctcccggccaacacgccgattcaatacaagtacatccgc
aagtacaaaggtgccacgacctgggagaaggatcccaacaagcggatcaccacaccttcc
ggcgacacgtgcatcgtgaaagacagctggcgtggccggcgttag

DBGET integrated database retrieval system