KEGG   Heterobasidion irregulare: HETIRDRAFT_123323Help
Entry
HETIRDRAFT_123323 CDS       T03455                                 

Gene name
cyp51
Definition
(RefSeq) cytochrome P450 monooxygenase 51
Organism
hir  Heterobasidion irregulare
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 20666819
NCBI-ProteinID: XP_009547708
JGI: Hetan2_123323
UniProt: W4K5C7
LinkDB All DBs
Position
Unknown
AA seq 499 aa AA seqDB search
MVLGGLTLTECVFALTSALLGVRWYLKRGSNLDSIPTVGFSGPILSYITAVQYLFKGNEL
VQEGYDKYKGGLFKIAMLDHWEVIASGSQTIEDVRKASDSVLSFMDAVARTLQVEYTLGP
EIHHNPYHVSIIRSQLTRNLGALFPDVREEIVASFNDIIPAKDEWVKYPAMETLMKIVCR
TSNRIFVGAPQCRDPDYNQLNVKFTIDVVKAALVINRFPDVLKPLAGRLFTSVPGSIRRA
IRHLAPIIEDRRAKLRDLGDDWNDKPNDMLMWLMEEARGDEQSTRNLALRILTVNFAAIH
TSSMSFTHALYPLAANPEYARILREEVESVVATDGWTKLAMGKMHKVDSFLRESQRFDGL
GVLTMQRHALKPFTFSNGQMVPTGTLLSCTSMSVHHDAENYTNADVFDPWRFSDMREGEG
EAAKHQMVSTTPEFLAFGHGKHACPGRFFAANELKAMLAHVVITYDVRFEDGGAPPPNLY
VGSACVPGKGHVLFRKRQV
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atggtacttggaggcctcactctcactgaatgtgtctttgcattgacgtcggcactgtta
ggggtcaggtggtacttgaagcgtggttctaatctcgactccatccccacagtcggcttt
tcgggtcctatcctctcctatatcaccgctgtacagtacttgttcaaaggcaacgagctc
gttcaagaaggatatgacaagtacaagggtggtctgttcaagatcgccatgttggatcac
tgggaagtgatcgctagcggttcacagacaatcgaggacgtccgaaaagcctctgattct
gtcctgagtttcatggacgccgtggcgcggacgcttcaagtggaatacactctaggaccg
gaaatccaccacaacccctatcacgtcagcataattcgctctcagctcacccgtaacttg
ggcgcactcttccctgatgttcgcgaggaaatcgttgcctcattcaacgacatcattccg
gcaaaagatgaatgggtgaagtacccagctatggagactctcatgaagatcgtctgtcgg
acaagcaaccgcatctttgtcggagctcctcaatgtcgcgatccagactataaccagttg
aatgtaaagtttaccatcgatgtcgtcaaagccgccctggttatcaatcggtttcccgac
gtcctgaaaccactcgcaggccgactttttaccagcgtccctggctccatcagacgtgcc
atccgccatctagctcctattatagaggaccgtcgtgcaaaactacgtgatctcggtgac
gactggaacgataagcctaacgacatgctcatgtggttgatggaagaagcgcggggcgac
gagcaatcaacccggaacctagctctgcgcattctcaccgtgaacttcgccgccatccat
acctcgtccatgagctttacccacgctctgtatcctctcgcggccaacccagaatacgcc
cgtatcctgcgcgaggaagtcgagtccgtcgtggctacggacggctggacgaagctcgcg
atgggcaaaatgcacaaagtcgacagcttcctccgagaatcccagcggttcgacgggctc
ggagttttgaccatgcaacgtcacgctctgaagcccttcaccttctcgaatggccagatg
gtccctactgggacgctgctgtcctgcacgtcgatgtcggtgcaccacgatgccgaaaac
tacacgaacgcggacgtattcgacccgtggcggttttccgatatgcgcgagggcgagggc
gaagcagccaagcaccaaatggtctccaccacccccgaattcctcgcgttcggacacggc
aagcacgcctgccctggtcggttcttcgctgcgaacgagctcaaggccatgctcgcgcac
gtcgtgatcacctacgacgtgaggttcgaagacggcggcgcgcccccgcccaacctctac
gtcggctcggcctgcgtccccgggaaaggacacgtcctcttcagaaagcgccaggtctga

DBGET integrated database retrieval system