KEGG   Heterobasidion irregulare: HETIRDRAFT_124459Help
Entry
HETIRDRAFT_124459 CDS       T03455                                 

Definition
(RefSeq) hypothetical protein
  KO
K06619  abelson tyrosine-protein kinase 1 [EC:2.7.10.2]
Organism
hir  Heterobasidion irregulare
Brite
KEGG Orthology (KO) [BR:hir00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hir01001]
    HETIRDRAFT_124459
Enzymes [BR:hir01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     HETIRDRAFT_124459
Protein kinases [BR:hir01001]
 Non-receptor tyrosine kinases
  ABL family
   HETIRDRAFT_124459
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase RIO1 Kdo APH
Motif
Other DBs
NCBI-GeneID: 20666875
NCBI-ProteinID: XP_009548154
JGI: Hetan2_124459
UniProt: W4K192
LinkDB All DBs
Position
Unknown
AA seq 1203 aa AA seqDB search
MTPKSPSLAAPGSPGGKSAPSPPLATHANSSDSTSTVRVSSPLNPARPHSGSPHTSPKQR
ALPLPSITTPPQAAGHTRAQSQSAAAITALPVDIPLARVASSPDGATSPASTWWNRKVHA
PRPWQESAKKKKTVPAEQTEGYAHTRQRVIEATASVLGVAAKVAHEGLFIGVDLLRFSPI
PGLEIAGVVLLNIWDALELVDMNRLACLRLTERCADILLSVRQEILDAGNAVSNELQAPI
ASLNESFNDVFAFLQKQAHRSFLHRYLKRDEILRSIAACDARLSDALGQFGMSIQIRTLK
LVQANEAHRAKEQAALIESINLGLRLSQPQLTIPEPLSSPPIGDATQIRAILHDIHQQQN
ERDLTRDIVDLRQLMRTALQTNSDAEMIEVLQVGRDEMPEAIKTLQRALEREVEREMLGE
SEASAMQASPGGESLYRSRGRLPGRSRAATVSAAADGGVRVFGTMVTTDSESGSSETSAR
PRDTLDREFMESGIDALRRLSQGQEVSLPSWTITRYEIDLEEKIGIGFFSDVYKGKWREH
TVAIKALAETTPRKLFVHEIGIWKTLMHPNVLELLGASSATGDPPYFLVSPYYSNGSLVK
YLKGLPDIAPVDFLKMIHEVAKGMEYLHEQGVLHGDLKGTNVLVDDRLHCVISDFGQSDM
KSEACRLSGSPLPHGTLRWQAPEMMSGAQAALTPEIDVYAFAMVCVEILTRGSLPWPMMD
DDAVKRFVLVDNIRPSLPLTRLSNSPLTNIIHAAWDANPLRRPSFKRISQDLEKLRVETG
YSVVESPRPPRFVDQWADSPTRASPDMRPIPLPGFPRESPSLPFLTCMKKLRSPFPAKDD
LEVGASSSPAVSDTTLETARGRSLSPIPGLGLTHERPLDDPTHVLQPRGSRASTISLPDT
TPDESASETSQIIPYTGYDSPPLADEVTAHARDERRYRMLLQHEYHTSLTLPLWSPAPVE
LGAVGYLSRPAGAFITLFNSFDPSKTSDGLANSLPNLSDFGKVTHRSQRQDKRNPAQRGM
DYLQNLLARKNRDASTPPVVGRTQSFQLRMGHKVAYLYAESTVYRYVEDLGVPKQWFQAT
IDRVLELYGREHKISKEDVFLVIGTLDVPDYALFVSHSHPDGQVNFNVYTGVKPGQEWGA
FSTTMADLSSSMLGGPLYHEEMVGNPLSASNISRVKESSSSPWDSVLLARLRFKTDAAEP
TSL
NT seq 3612 nt NT seq  +upstreamnt  +downstreamnt
atgacacccaagtcaccttctcttgcagccccaggctctcctggaggaaaatctgctcca
tcgcccccgttggcgacccacgcgaactcctcagattctacatccaccgtccgagtctca
tcgcccctcaatccagctcgtccacactccggctctccccacacgagtcccaagcagaga
gccctccctcttccatctatcacgaccccaccgcaagccgctggtcatacgcgtgcacag
tctcaatcggccgcagccatcactgcgcttccggtcgacattcctctagcgcgcgtcgcc
tcaagtccggatggagccacttcgccagcatcgacctggtggaaccgcaaagttcacgcc
cctcggccgtggcaggagagtgctaagaagaagaagactgtcccggctgaacaaacagag
gggtacgctcatacacgacaacgcgtcattgaagctactgcttctgtcttgggtgtagca
gctaaggtcgcacacgaaggccttttcatcggagtcgatttgctccgcttttcgcctatc
ccaggactcgagatcgcaggcgtcgtcctgttgaacatctgggatgcactagaactggtg
gacatgaacagattggcctgcttgcgtctgacggagcgttgcgcagatatcttactatct
gtacgacaagaaattctggatgccggaaatgccgtcagcaatgagctccaagctcccatc
gcctcgctaaatgagtcgttcaatgatgtgttcgcgtttctacagaagcaagcacaccgg
tcgttcctccaccgttacctcaagagggacgagattttgcgtagcatcgccgcctgcgat
gcaagattgagcgatgcactcgggcaattcggaatgtcaatccaaatccgaactctgaag
ctggtccaggcgaatgaagctcatcgagcaaaggagcaggctgcgctgattgaatcaatc
aacctcggcctccgattgtctcagccccagctcacaattcccgaaccgctttcttcccct
ccaatcggggacgccacacaaatccgcgcgatcctgcacgacatacatcagcagcagaat
gagcgcgacttgacccgcgatatcgtggacctgcgccagctgatgcgcaccgcactgcag
accaacagcgacgcggagatgatcgaggtgctccaggtcgggcgagacgagatgcccgag
gcgatcaagacgctccaacgcgcgcttgagcgggaggttgagcgggagatgctaggggag
tcggaggcctccgcgatgcaggcctcacctggtggcgaatcgctgtaccgctcgcgaggt
aggctccctgggcgctcacgggcggccacggtgtcagccgcggcggatgggggtgtgcgg
gtgttcgggacgatggtgaccacagacagcgagagtgggagcagcgagacgtcggcacgc
ccgcgagatactcttgaccgagagttcatggagagcgggatcgatgcattgcggcggctg
agccaaggccaagaggtttcgctccccagctggaccatcacgcgatacgagatcgatctg
gaggagaagattgggattgggttcttcagcgacgtatataagggcaaatggagagagcac
accgtcgcgatcaaggccctcgcggagacaacgccgcggaagctatttgtgcacgagatt
ggcatttggaagacactcatgcacccaaacgtcttggaattattgggtgcttcgtcggcc
actggggacccgccttacttcctggtgtcgccatactacagtaatgggagtttggtcaaa
tacctcaagggcctgccagacatcgctccagttgactttctcaaaatgattcatgaagtg
gcgaaggggatggagtacctgcatgagcagggagttctgcatggtgatctcaagggtaca
aacgtactggtcgatgatcgtttgcattgcgtcatatctgatttcggccagagcgacatg
aagtctgaagcatgcaggcttagtggctcccctcttccccacgggactttgcgctggcaa
gctccggagatgatgtcaggagctcaagctgctctcactcctgaaatagatgtttatgca
tttgcaatggtgtgcgtcgaaatcttgacaaggggaagtctaccatggcctatgatggat
gacgatgcagtgaagcggtttgtgctagtcgataatattcgcccttcactgcctctcact
cgtttgagcaacagcccgttaaccaacatcattcacgccgcgtgggatgccaacccactt
cgccgtccttctttcaagcggatctcacaagatctcgagaagctgagagtcgagacagga
tatagtgtcgtggaatcgcccagaccaccaagatttgtagatcagtgggcggacagtccc
acccgagcctcacctgatatgcgccccattccgttacctggcttcccccgtgagtcgccg
tctcttccgttcctgacatgtatgaagaaactaagatcgccgttcccagccaaggacgac
ttggaagtaggggcctcaagttcgccggccgtatctgataccacattggagacggcgaga
ggccgttcactgtctcccattcctggactcggacttactcacgagcgtccgctcgatgac
ccaacccatgtattgcaacctagaggatccagagccagcacgatatctctccctgatacc
acccctgacgagagtgcatccgaaacaagccagataatcccttatacgggatatgactct
ccgccactggcagatgaggtgaccgctcatgctcgcgatgagagaaggtacagaatgctc
ttgcagcatgagtaccacacatctttgacgttacccttatggtcacccgctcctgttgag
cttggtgctgttgggtacttatctcgtcccgcgggggctttcattaccttgttcaactcg
ttcgatccctcgaaaacctccgatggacttgctaactcgttaccgaatctatccgatttt
ggcaaggtgacacaccgcagccagcgacaggacaaacgaaatcctgctcaaagggggatg
gactatcttcagaacctccttgcgagaaaaaatcgagatgcatctactccgccggtggta
ggccgcacacaatcatttcagctgcggatgggccacaaggttgcctatctgtatgccgag
tccactgtgtacaggtatgtggaggaccttggtgtgccgaagcagtggtttcaggcgacc
atcgaccgtgttcttgagctatacggtcgggagcacaagatcagtaaagaggacgtcttt
ctcgtgatcggcacgctagacgtaccagactatgcattgttcgtaagccatagccatccc
gatgggcaggtcaacttcaatgtatacacgggcgtaaagccgggacaggagtggggcgca
ttctcgactactatggctgacctgtcttcgtcaatgctgggggggccgttgtatcacgag
gaaatggtcggcaatcccctttccgcaagtaatatttcccgggtgaaagaatcgtcctca
agcccctgggattctgttctattggctcggctcagattcaagactgatgctgcggagcca
acgtccttatga

DBGET integrated database retrieval system