KEGG   Heterobasidion irregulare: HETIRDRAFT_124986Help
Entry
HETIRDRAFT_124986 CDS       T03455                                 

Definition
(RefSeq) hypothetical protein
  KO
K11484  histone deacetylase HOS3 [EC:3.5.1.98]
Organism
hir  Heterobasidion irregulare
Brite
KEGG Orthology (KO) [BR:hir00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hir03036]
    HETIRDRAFT_124986
Enzymes [BR:hir01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     HETIRDRAFT_124986
Chromosome and associated proteins [BR:hir03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     HETIRDRAFT_124986
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 20666891
NCBI-ProteinID: XP_009546035
JGI: Hetan2_124986
UniProt: W4K6L7
LinkDB All DBs
Position
Unknown
AA seq 613 aa AA seqDB search
MTAVFLQDACLKHRFIRSRDSSNIVERPERLRAVKLGVSAAIACLEGSIPVGKQVPEDSL
DSERGSPLRAADVSQVEAGAEADILAEAMGRMNIAPATSLEEFPLSRSLRIRVFRSSAQI
NILNHAAVKFVHGDIDGDVYLEKLKVWARDSAEKIAAGQSEIPEGLSQGDLYLSPGSLDA
MQGALGTVCEAVDTVIHSGLPNTSEEQLPPARRAFVAIRPPGHHCGEDTPSGFCFLNNVA
VAAAYAHLTHGIQRVVIFDVDLHHGNGTQSIAWQINEESYREKLESEFSGPGTPSSKPGL
QVYYGSVHDILSYPCEDGKIELVQAASVSIHGPHGQYIENVHLEPYESEEQFWRSLYEGA
YSRLLKKAQQFLESTGGKSDETMVFISCGFDASEHEYASMSRHARKVPTSFFHRFTQDAC
SFANKWAYGRLVSVLEGGYSDKALSSGTMAHILGLVDGGYGDAVSKTEERQPWWSKDNVN
LLEKLSKKRRGPKTSISTADPDTIAFLDRTTALLSLFDPASNYLSSVKDTPVPPSSMSLR
SRRKADSSSSAAIRAEHQTFTKSDARKTGTKDESLSSSASMSTTSESDMSPPVMAKKLPK
VILKVGPPPKRSI
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atgactgctgttttcttacaggacgcttgcttgaaacatcgtttcatccgctcccgagac
tcttcaaatattgtcgaacgtcctgagcggctgcgagccgtcaaacttggtgtatctgct
gctatcgcatgtctagagggttctattcctgtgggaaaacaggtacccgaggattcttta
gacagcgaaagggggtcgccactacgcgctgctgatgtttctcaagttgaagctggggct
gaagcagatatactagctgaagccatgggtcggatgaacatagcccccgcaacaagtctc
gaagagtttcccttgtcccggtcactgcgaatccgtgtttttagaagctccgcacagatc
aacatactcaaccacgcagctgtgaaatttgttcacggcgacatagatggggacgtctac
ttggagaagttgaaggtctgggcacgggacagcgctgaaaagattgctgcgggacaatct
gagatccctgaaggcctctcacaaggagatctatacttgtccccaggctctttggatgcc
atgcaaggggctcttggcacagtatgcgaagctgtagacactgttatacattcaggcctc
cccaacacgtcggaagaacagttgcctccagcgcggagagcctttgtagccatccgacca
ccaggtcatcactgcggtgaggatacaccatcaggattctgcttcttgaataatgttgcc
gttgccgccgcgtatgctcatttgactcacgggatccaacgggtcgtcattttcgatgtc
gatctacatcacggaaacggaacgcagtcaatcgcgtggcagatcaacgaggaaagctac
agagaaaagctcgagtctgaattttcaggacctggcaccccttcttccaagccaggatta
caagtctattacggctccgttcacgatattttgtcctacccctgcgaggatgggaagata
gaattggtgcaagccgcttccgtctccatccatggccctcacggtcagtacatcgaaaat
gtgcatttggaaccatacgaatcggaggaacaattctggagatccctctacgaaggagct
tacagccgattgctcaagaaggcccagcaatttctcgaaagcactggcggcaagtcagac
gaaaccatggtatttatcagttgtggcttcgatgcttccgagcatgagtatgcatccatg
tctcgacacgcgcgaaaggttcctacatcattttttcaccgcttcacgcaagatgcgtgc
agtttcgccaacaaatgggcatatggcaggcttgtcagtgttctcgaaggcggttatagt
gacaaggcactgtcgagtggaacgatggcgcatattcttgggttggtagatggcggatat
ggcgacgcggtgtccaagacggaggaacgacaaccgtggtggagcaaggataatgtcaat
ttgctggagaaattatcaaagaaacgtcgtggcccgaagacatccatctcgacggcagat
cccgacacaatagcgttccttgatcgtacaactgccctcttatccctgttcgatcccgcg
agcaattacctgtcgtccgtcaaggatacccccgtgcccccttcttctatgtcgttacgg
agtcgaagaaaggcggactcgtcgtcttcagctgcgattcgagcagaacatcaaaccttc
acaaaatcggatgcaaggaagactggcacgaaagacgagtctttgagctcgagcgcatct
atgtccacaacgtctgaatctgacatgtcaccaccagttatggcgaagaagttgcccaag
gtgatcttaaaggttggaccgccaccgaagagatctatttga

DBGET integrated database retrieval system