KEGG   Heterobasidion irregulare: HETIRDRAFT_164952Help
Entry
HETIRDRAFT_164952 CDS       T03455                                 

Gene name
GST6
Definition
(RefSeq) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
hir  Heterobasidion irregulare
Pathway
hir00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:hir00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    HETIRDRAFT_164952 (GST6)
Enzymes [BR:hir01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     HETIRDRAFT_164952 (GST6)
Transporters [BR:hir02000]
 Other Transporters
  Pores ion channels [TC:1]
   HETIRDRAFT_164952 (GST6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C GST_N_4
Motif
Other DBs
NCBI-GeneID: 20667951
NCBI-ProteinID: XP_009553302
JGI: Hetan2_164952
UniProt: W4JMQ2
LinkDB All DBs
Position
Unknown
AA seq 256 aa AA seqDB search
MAIADADLFPHATGEAAKTVAKHTEPQELVFYAGWFCPYAQRGWIALEEKGIPYQYKEIN
PYHKEKHFLAINPKGLVPAIEYQNKPLYESLIISEFLEDAFPTHEPHLLPADPFARAQAR
LWIDHISKAVIPAFQRLLQSQEAPKQAAALEELKTALRTLAQNAKGPYFFGEGWSLVDTA
IAPWVTRDYIQQEHRGYKREDVSPEWVAYAGKLETRESVVKTRSEKRHYEPIYGRYLRDE
AQSEAAKAIRAGRVIP
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atggccatcgccgacgcagacctcttcccccatgccactggcgaggcggctaagaccgta
gcaaagcatactgagccacaggagctcgtcttctacgcaggatggttctgcccatatgct
cagcgtggctggatcgctctggaggaaaaagggatcccgtaccaatacaaagagatcaac
ccttaccacaaggagaagcacttccttgccattaacccgaaggggctcgtcccggcgatc
gagtaccagaacaagccactctacgaatccctcatcatcagcgaattcctcgaagacgcc
ttccccacccacgagccgcatctcctccccgccgatcccttcgcccgcgcgcaagcacgc
ctctggatcgaccacatcagcaaggccgtcatccccgcgttccagcggctgctccagtcg
caggaggcgccaaagcaggcagccgcgctcgaagagctcaagaccgcgctgcgcacgctc
gcgcagaacgccaagggcccgtatttctttggggaggggtggagtttggtcgatactgcc
atcgcgccatgggtgactagggattatattcagcaggaacatcgtgggtacaagcgggag
gatgttagccctgagtgggtagcctacgcgggcaagctggaaactagagagagcgtggtg
aagaccaggagcgagaagcgccattacgaacctatctatggcaggtacctgcgcgacgaa
gcgcagagtgaggccgcaaaggccattcgagcaggaagagtcatcccgtaa

DBGET integrated database retrieval system