KEGG   Heterobasidion irregulare: HETIRDRAFT_181101Help
Entry
HETIRDRAFT_181101 CDS       T03455                                 

Gene name
sodc
Definition
(RefSeq) Cu2+/Zn2+ superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
hir  Heterobasidion irregulare
Pathway
hir04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:hir00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    HETIRDRAFT_181101 (sodc)
Enzymes [BR:hir01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     HETIRDRAFT_181101 (sodc)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu CHRD
Motif
Other DBs
NCBI-GeneID: 20668570
NCBI-ProteinID: XP_009546315
JGI: Hetan2_181101
UniProt: W4K7C2
LinkDB All DBs
Position
Unknown
AA seq 214 aa AA seqDB search
METYRAALVNSKGNRTVIFVGLVTAAIMLVLWGLLEPASPPTIRKAVVVLSGPESKAFGT
VAFEQVSSTGAVTVTGDLQNLDPSARRGFHIHQLGDTTNGCLSAGPHFNPYNKNHGAPSD
SERHVGDLGNIESDRFGIAKFTIQDSMITLNGPLSIVGRTVVLHTGVDDLGKGNNAESRK
TGNAGARSACGIIGTIYFFYLLHFLCSNSPDRDC
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atggagacgtaccgcgctgcgcttgtcaatagcaaggggaataggactgtcatatttgtc
ggcctggttaccgctgctattatgctcgttttatggggattgcttgagccggctagtcca
ccaacgattcgcaaggcagttgtcgtgctctctggaccagaatcgaaggcttttggcaca
gtggccttcgaacaagtttccagtaccggggcggttactgtgactggagacctccaaaac
ctcgatccttcagccagacgcggtttccacatacaccaactaggcgatacaactaatggt
tgcttgtcggctggcccccatttcaacccatataataagaaccatggcgccccttctgac
tcagagagacacgtaggcgatctcggaaacatcgaaagcgacaggtttggtattgccaag
ttcacgatccaggatagcatgattactttgaacggacctttaagcattgttggtcgcact
gtggtcttacatacgggcgttgatgaccttggaaaaggtaataacgccgagtctcgaaag
acaggaaacgccggcgcacgatcagcgtgtggcatcattggtacaatatatttcttttat
ctactccatttcttgtgctcaaattctccggatagggattgctga

DBGET integrated database retrieval system