KEGG   Heterobasidion irregulare: HETIRDRAFT_324675Help
Entry
HETIRDRAFT_324675 CDS       T03455                                 

Definition
(RefSeq) hypothetical protein
  KO
K04728  serine-protein kinase ATM [EC:2.7.11.1]
Organism
hir  Heterobasidion irregulare
Pathway
hir03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:hir00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    HETIRDRAFT_324675
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hir01001]
    HETIRDRAFT_324675
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hir03032]
    HETIRDRAFT_324675
   03400 DNA repair and recombination proteins [BR:hir03400]
    HETIRDRAFT_324675
Enzymes [BR:hir01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     HETIRDRAFT_324675
Protein kinases [BR:hir01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   HETIRDRAFT_324675
DNA replication proteins [BR:hir03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     HETIRDRAFT_324675
DNA repair and recombination proteins [BR:hir03400]
 Eukaryotic Type
  Check point factors
   Other check point factors
    HETIRDRAFT_324675
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3_PI4_kinase TAN FATC
Motif
Other DBs
NCBI-GeneID: 20671070
NCBI-ProteinID: XP_009549441
JGI: Hetan2_324675
UniProt: W4K1G8
LinkDB All DBs
Position
Unknown
AA seq 3066 aa AA seqDB search
MNTLKAVCRQLGSEKVKDRQEGLSSVRTVFSRDSVIDNLDEHGTGKPWLAIFQALFETAI
KEKAICTKPTTKSGSTNTAERRLSEVASVIRWLTERSVHVLHRKTIKVLLIHLLQMCVYQ
GQLYTPVALDYAKTIRCVVSYTPHLEHLDNETWVRIVEMGFNVVLGDSLRVRIGGEEGDE
EGSIDMGTEGGDSDLSHDDENDTFATTSTQTKKRRRREASGTPGPSFPRPSPSSTKVLRS
VSLEQIEFASLLAILLRSPSVPLLSSKYPCLANDVLTRLLRFIRNYSEDTSLHQDFLAAL
SATLSHLALNKRSAVSQFALGAWDGLIGIWGTKNKSMKEGLIVVLRILFPYYTADDPKMK
EVSLDGPHIDGITKLWNLLGGTVDNRWGFQGLSLDSLRLQLTLPDDLEGCGPAAFVARTF
RYGWNFDPAQALAWAILELQADCAAKLFLLSESIHSASQYSKRDGKRIKLDNPISSVLDS
VRTQTPSAVRAYNLQRLLFIIDRHWSIFHNSLRQDIMSTLLQFLTFDDAVVQSWTFLCLS
AIADRQMSLGQPAAQEFNGPSTWDPIWTHAMRRAVVPVVCRAACHVAYTLLYHSKRLLNS
QRVLVEIETFAKDLDVQGPPFPYDSVCVFMALCLQVAVQDMRLYRMHLEGKVLSWLVDSW
SLGVTRIARGSSLDGSRTKSTHPSVADMMTLLESICGLSKRSSLICRAMLPECAIVQEMQ
DEYRTAIIRGFLLYAQLPPFHRHHKLESNLSITPTLPPANANKLTDLAQPGSRERRVSAA
LLKFLESLVLDWESLPETAVHLSAEKARRFLDCAILALSFESLLVFNGIWSNRRVLQTAC
KLIAHVVPLLKMQRWTLEEKAVVLLGFEPLIASEEEQDHAGWEGLLSPVQGTGIRNSVLQ
ELTSNVKQKRRQMAMSRRELQRIIWRSSDVQDVSAKVMVVMKDVLRITLSKLTGGNSSSH
PMDINDEDDFAPIRTALPAATSFPETHRQTHGASSAQYIITVCMSFLALGPILQSPSGEP
TRDKELTMLILNSNADEFLLASPSYFSNVRQRTMNLNITALDNFLDKFESLLLQYTYSRS
ETLQLLVIQFLDSTVSLWTEESVVSEQAGEHARSLCRWLLETLRTNKIRSWRIRDSLVAF
LDRYLAEDPLELVWSVPYPGENGEEIKSGVVPTTVLPTMSIDEDIRVRFRVACVNARLFT
LSRFRNGDSMELYGKIHSHLSTQLTEYEHMLTRFITLGNIMVVSSAVRRGPYWHLLEACN
FTDDYSRHIEAVFSGVSERMGLSRTAELFEIYISQIAYSIYKGGHDFLRFSPRVLGYRDR
RDCAEAAFRAFTSVNILAGDNAEEVTQGQHFFVNHCKAVSKSVTQGFRECFADLVGYQLT
RSVEALVESGANAFSNALEHSLIVKFAHWDPDMVLDKQMQRDVDGIVVAILRTLGDQDCS
PDGSIVQELRLHQSDRAAEIFQHLTHHRIHNDTFAHRPNLPAFETKSVLLTLNWFAARIP
DAVSTATSYHVLHQLLAAIQQSPLVNEQLRCLNALCLWISCHYRHFREPIILHALVNGAS
SLLTQIDLARAAQSILQWAFAQYSKSTEKDLRLSDVLIRICCLAHDYSMSVDINVSRIGN
DLLQWLEYQVVYLSTMPHIKPQVINALTAWPRKLTANLALLYQDVSLSSLSSILADPRIT
SNKFRIVRRFRDLSIAKQYPSAQFSRIDFWRLKDCIPPSPELQDDDIDAFAILLLVQKGQ
VHSFGTNLLSAQVTHHRRQCISQTKVSKDSAPMVDPSDSERSILEALLLMLDSDDPVRVN
SAYRVLRTLASTELPDLQLWSSEYINEMAYFRIRPLPSLKRPAAVIDSLESPSFVDIAKD
FRTWVSTVATLISDVLSVSNPFYSQLSVILQSDTSFAGLTLPILTHTMLRGDLASTATTD
GRSCRTILSRYFASVLSSTDSDVQSLRAVVDVALHLRQCRPGHSSDALAYDKWLDIDLIL
LSKSAIACGAYTTALLFHELAVEYQGEIMVNKADDAERILFDIYSHIEEPDSFYGIKARD
FHHFLMKRLHHEKQWEKAFQFHGAALEANSRDPGEAEGVLQSLHSFGFDNLALSVQHHAS
DTMGGVHASAAMSYHLGWRTETWDLPEKIGTDDSGAALYQALRAVYRERDTRSIDTTVRA
ALLKEMERLRLMADEDLVGIHEVTQNIICLHQVKLWGSNEIQKCLQSKDLKAIQWADFSQ
IDPEFDFPVLESIMATRIALLRSVRQKEQRTLIGTMRTPFVSELYDIEKQCLLRISEAAR
ESQNLQIALNSVTRAQNLELKEASPALSQELSHVLWLKKEPKSAVGYMKELIKRHFPAAK
LQSSSLRLQKAQLLARLGAWSSEACLQKPTDIWSHYFDPAATLLSDIAAPDSTHATVYHE
CAMFADRQYQAIVKSPDAIRLKMYVDRKEKEIHDRHKQIKQMSKSSREYGDLARDQNKAE
KQLQEDEARYHKHTEARNIFLQQAIDMYSRCLEASDAFDDDAHIRLTSLWFANFDDLPLQ
TKVRESVGRVPSRKFVFLAHQLSARLSKPSKETMPTSQETLQALVLRMCSDHPFHSVYQV
YCLMPHPSSSAPSRRLSARHDHSFSQGERAAAATDIFDRLRSDSSSGTRISSIEEVCYAS
IHWAKFPVKEKGNSNQKKPVGPFPIPETAPIRKLQNVPVPVLTAHTPLDPTARYQDCVWI
SHYETMYDTAGGVNLPKITTCCGSNGTRYKQLVEGDDDLRQDAVMEQVFDLVNVVLRRDR
ETRKRNLNIRAYKVIPLEVQAGIIEFVGNTSPLVSWLLKAHPKYNPTDISREEFYKKMYE
LREKYKRDSTVNSRLIALFAELKLRFRPVMRHYFTEKHKLPMSWFAMRLNYTRSVATTSI
VGHILGLGDRHTSNILMDNATGEVVPIDLGIAFEQGKLLPIPELVPFRMTPDMVDGMGTS
GTQGVFQRCAEETLRVLREGSEVILTVLEVFKYDPLHSWTATEMKLKRVQGGTTGTAQQQ
PTHDQTHLGIGIDMSSGGVDEAADRALTSVARKLDKSLSVEYTVNELLAEATDPANLACM
FIGMSA
NT seq 9201 nt NT seq  +upstreamnt  +downstreamnt
atgaacactctcaaggctgtctgtaggcagctagggagcgaaaaagtcaaagacagacaa
gaaggcctatcctccgttcgcactgttttttctcgtgactctgtaatcgataacctcgac
gagcatggcaccgggaagccttggctcgctatcttccaagccttatttgagacagccatc
aaggaaaaagcgatatgcaccaagccaacgaccaagtcaggctcgacaaatacagcagag
aggcgacttagcgaggtagcctctgtcatcagatggttaacggagagaagtgtacatgta
ctacacaggaagaccatcaaggtactcctcattcatcttctacagatgtgtgtctaccag
ggacagttgtataccccagtcgctctggactatgccaaaaccatacggtgtgtggtcagt
tatacgccacacttggagcatctggacaacgaaacttgggtgagaattgtggagatgggc
ttcaatgtggtcctaggtgactcattgagagtgaggattggtggtgaagaaggcgatgaa
gaagggagcattgacatgggtacggaagggggcgactcagatctctcgcacgatgacgaa
aacgacacttttgctacaacctctacccagacgaagaagcggcggaggcgagaggccagc
ggaactccaggaccgtcttttcctcgaccatctccttcctctacaaaggtcttacgctcg
gtctccctggaacaaatcgaatttgcatccctcctcgcaatccttctccggtcaccttct
gtgccgctcctgtcttctaaatatccttgtctggcaaatgatgtcttgacccgccttctt
cgatttattcggaattattctgaagatacatccctccaccaagacttcctcgctgcgcta
tctgctacactttctcaccttgccctgaataagcggagcgccgtttctcaatttgctctc
ggtgcctgggatggtctgatcgggatatggggcaccaagaacaagagcatgaaggagggc
ttgatcgttgtactaaggatattgtttccctattacaccgcagacgatccgaagatgaag
gaggtttccctcgatggcccacatatagatggtataaccaagctttggaatctactcggc
ggcacggttgataatcgttgggggtttcaagggctatcacttgactctttgaggctacag
ctcaccttacctgacgatttggaaggatgtggtcctgcagcttttgttgctcgaacgttt
cgatacggctggaattttgatcctgcccaagcattagcatgggcaatccttgaattacaa
gctgactgcgcggcaaagctgttccttctgtccgaatccatccattctgcgtcgcaatac
agcaaaagggatggaaaaagaatcaagcttgacaatcctatctcatcggtgctggattct
gtccgaactcagacaccttctgccgttcgcgcgtacaacctccagagattactatttatc
attgatcgacactggtccatatttcacaacagcctccgtcaggacataatgtcgacatta
ctccaattcttaacttttgatgatgctgtggtccaatcttggactttcttgtgtctttct
gccatcgcagacaggcagatgtccctcgggcagccagcggcacaggaattcaatggacca
tcgacttgggaccctatttggacgcatgcgatgcgaagagcggttgtccccgttgtctgt
cgtgcagcgtgtcatgtcgcgtacacgcttctctatcattccaagcgtctcctcaactcg
cagcgcgtcctggtggagattgagactttcgccaaagaccttgacgtccagggtcctcct
ttcccatacgattccgtgtgcgtcttcatggcgttgtgtctacaagtcgctgttcaggac
atgcggctctatcgcatgcatctggagggaaaggttctcagttggttggtcgacagctgg
agccttggtgtcacgcgcatagctcgagggagctcactggatggtagcaggaccaagtca
actcacccctctgttgccgacatgatgaccttactagagagtatctgcggattgtcgaag
aggagcagtttgatttgtcgggcaatgctaccggaatgtgccatcgtacaagagatgcag
gacgagtatcgaacagccattatccgcgggttcctgctctacgctcaactgccccctttt
catcgacatcataaactggagtctaatctgtcaatcacccctactctaccgccagcaaac
gccaacaagcttacagatcttgcgcagccaggcagtcgtgagaggagagtttccgccgct
ctcctgaaattcttagagtccctcgttttagattgggagagtctaccagaaacggccgtt
catttgagcgctgaaaaggctcgacgctttttagactgcgcaattcttgctctgtctttc
gagtctcttctggtttttaatggcatctggtcgaacaggcgtgtattgcagaccgcttgc
aagctgatcgcccacgttgtgcccctcttaaagatgcagcgatggactttggaagaaaag
gctgtcgttctcttgggctttgaacccctgattgcgtctgaggaggaacaggatcatgcg
ggttgggagggactgctatcgccagtacaaggcactgggatacgaaacagtgtgctgcag
gaattgacatcgaacgtgaaacaaaagcggagacaaatggcaatgtcacgacgcgagttg
caacgaataatctggcgcagctcggatgttcaagatgtttccgcgaaggttatggttgtt
atgaaggatgtgcttcggattacactgtccaaattgacgggtggtaacagctcatcgcat
ccgatggacattaatgacgaagacgactttgcaccaattcgaacagcactacccgccgct
accagttttccggaaactcacagacaaacacatggagcgtcgtctgcccagtatatcatc
acagtttgcatgtcctttctagccctcggcccaatccttcagtcgccatcaggagagcca
actagagataaagaactgactatgctcatcttaaacagtaatgcagacgagttcttatta
gcaagtccatcatatttcagcaatgtgcggcaaaggactatgaacctcaacatcacagcc
ctcgacaacttcttggacaagttcgaatcattgcttcttcaatatacctattcacgaagc
gagacgctacagcttctagttattcaattcctagattccactgtgtctctgtggactgag
gagtctgtagtcagtgaacaagcaggcgaacacgctcgctcgctatgtcgctggcttttg
gagactctcagaacaaacaaaattcgatcttggaggattcgagactccctagttgctttt
ctagacagatatctcgccgaagatccattggaattagtttggtctgtaccatatcctggc
gaaaatggcgaggaaatcaagtctggtgtcgttccgaccactgtgcttcctactatgagt
atcgatgaagatattcgtgtccgctttcgggttgcgtgtgtcaacgctcgtctgttcacc
ctttcgcgcttcaggaacggtgattcgatggagctctacggtaagatacacagccatttg
tcaacgcaactcaccgagtatgagcatatgctaactcgattcatcaccttaggcaacatc
atggtcgtcagttcagcagtccgaagagggccttactggcatctattggaagcttgcaat
ttcactgatgactattctcgtcatatcgaggcagtcttcagtggtgtttccgaacggatg
ggcttatccaggaccgccgaactctttgagatctacatatctcaaatcgcgtactccatc
tataagggaggtcacgactttctacgattttcccctcgtgttttaggataccgtgatcgg
agggactgtgccgaggctgcttttcgtgctttcacctcggtaaacattcttgcaggtgac
aatgctgaagaagtcactcagggacaacacttctttgtcaatcattgcaaagcagtctcc
aagtctgtcacacaaggttttcgagagtgctttgcggatctcgttggttaccaattgact
cgttcagtagaagctctcgtggagtctggggcgaatgcattttcaaatgcactggaacat
tccctcatcgtgaaattcgctcattgggatcctgacatggtgctagacaaacaaatgcag
agagacgttgatggcatcgttgtcgctatcttgcgaactcttggcgaccaagattgcagt
ccagatggcagtatcgtccaggagctgcgactacatcagtcagatcgtgctgctgaaatc
ttccaacacttgacccatcatcggattcacaatgacacctttgcccatcgaccaaacctg
ccagcttttgaaaccaagagcgtccttttgaccttgaattggtttgcagcacgaatacct
gatgctgtgtcaaccgcgacttcgtatcatgtcctacatcaactactcgcagctattcaa
caatcgcccttggtcaatgagcaactacgttgtcttaacgccttgtgcctgtggatatca
tgccactatcggcactttcgagagcccataatccttcatgctctcgtcaacggcgcttct
tcgttgctgacacagattgatcttgcccgtgcggctcagtccattctacagtgggctttt
gcgcagtactcaaagagtacggaaaaggatttacgtctttcagatgttctgatccgcata
tgttgtttggcgcacgactattccatgagtgtggatatcaacgtttctcgcatcggcaac
gatttacttcaatggctcgagtatcaagttgtatatctctcgacgatgcctcacatcaaa
cctcaggtcatcaatgctttgacggcctggccacgaaaactcacagcaaaccttgccttg
ctctaccaagacgtctcattaagcagcctctcatcaatcctcgccgatccccgtatcacg
tcaaataagttccgtatagtcaggagatttagagacttatctatcgccaagcagtatcct
tcagcgcagttctctcgcatagacttctggcgacttaaagactgcatcccaccttcccct
gaacttcaagatgatgatatcgatgcctttgcgatcttgcttttggtgcagaagggacag
gttcacagctttggaacgaatctcctcagtgctcaagtgacgcatcaccgacgacaatgt
atctctcagacaaaagtatcgaaggattctgcgccaatggtggatccctcagattctgag
cgctccattctagaggcgttactgttgatgcttgactctgatgaccccgtccgagtcaat
tctgcctatcgtgttttaaggactctagcgtcaacagaattgccagatctccagctctgg
tcctctgaatatatcaacgaaatggcttactttcgtatccgccctcttccctccctaaag
agacctgcggccgtcatcgacagcctggaatcgccgtcttttgttgatatagcgaaagat
tttcggacgtgggtgtccacagttgctaccctgatcagcgatgttctcagtgttagcaat
cctttctattcacaactctccgtcattctacaatcagacacatcattcgcaggcctgact
ttacccatccttacgcacacaatgttacgcggcgatctggccagtacggcgacgacagat
ggaaggtcctgtcgaacaattctctcccgatatttcgcgtccgtcctctcttcaacagat
tctgatgtccagtctcttcgtgccgtggtggacgttgctcttcatctgcgacaatgccgt
cctggacactctagcgatgcccttgcatatgacaagtggcttgatatagatctcatcttg
ctcagcaaaagtgcgattgcctgtggagcatacacgacggctctcctcttccatgagcta
gcagtcgagtatcagggcgaaattatggtcaacaaggccgacgatgccgagaggatactg
ttcgatatatacagtcatattgaggagccggacagtttctacggtatcaaagcgcgcgat
tttcatcatttcttgatgaaacggcttcatcacgaaaaacaatgggaaaaggcatttcag
ttccatggcgctgctctagaggccaatagtcgagatccgggtgaagcagaaggtgttcta
cagtcacttcattcgttcggctttgacaacttagctctcagtgttcaacatcatgcatcc
gataccatgggaggagtacatgcatccgctgcaatgagctaccatttaggttggcgtaca
gaaacatgggacctaccagaaaagatagggacggatgactctggtgctgcattgtaccaa
gctctccgagctgtctatcgtgaacgtgatacacgatccatagacacgaccgtgagagcc
gcgcttctaaaagaaatggaacgactgcgcttaatggcggacgaagacctggttggcatt
cacgaggtgacgcagaacatcatttgtcttcatcaggtcaagctttggggcagcaatgag
atacagaaatgccttcaatcgaaggacctcaaagccatacaatgggcagacttcagccaa
attgaccctgaattcgactttccggtgctggagagtattatggctacgcgcatcgctctc
cttcgatctgtgcgccaaaaagagcaacgaacgctaatcgggacgatgcgtaccccgttc
gtttctgagctgtatgatatcgagaaacaatgtcttctccgcatctctgaggcagctcgc
gagtcgcaaaacttgcaaattgcgctaaattcagtcactcgagcgcaaaacctggagttg
aaggaggccagccctgctctctcgcaggaactttcccatgttctttggctaaagaaggag
ccaaagtctgctgtcgggtacatgaaagaactcattaaacgccactttccagctgcaaaa
ctccaatcttcgtctctccgcctccaaaaagcccagctactcgcccgtctcggagcttgg
tcgtccgaagcttgtcttcaaaagccaacggatatctggtctcattatttcgatcctgct
gctaccttgctgagcgacattgctgccccagactcaacgcatgccaccgtctatcacgaa
tgtgcaatgtttgcagataggcaataccaagcgatcgtgaaatctcccgacgccatccgg
ctgaagatgtatgtcgatcgcaaggagaaagagatccacgatcgccacaagcaaatcaaa
cagatgtctaaatccagccgtgaatatggagacttagcacgtgaccaaaataaggccgag
aaacagctacaagaagacgaggcacgatatcacaaacataccgaagctcgaaacatattc
ttgcaacaggccatcgatatgtattctcgatgtctggaagcgtccgatgcttttgatgac
gatgcacatatccgtttgacttctctgtggttcgccaacttcgacgatctgcctctccaa
accaaagttcgcgagtctgtggggcgtgtcccatctcggaaatttgtcttcttggctcac
caactctctgcccggttatctaaaccttccaaggaaacaatgccaacaagtcaagaaaca
ttgcaggccctcgtccttcgcatgtgcagcgatcatcctttccatagcgtgtatcaggtg
tattgcttgatgccccatccgtcgagctctgcacccagcagacgactttcagcccgacat
gatcattccttctcacaaggggagcgagcagcagcggctacagatatatttgaccgtctt
cgaagcgattcttcctccggtacaaggatcagtagcatagaagaagtatgctatgcttcg
atccattgggccaaatttcccgtcaaagagaaagggaacagcaaccagaagaaaccagtc
gggcccttccccattccagagactgctcctatccgaaaattacagaatgttcctgtccct
gtgctgacagcccatactcctctcgatccaactgcacgataccaagattgcgtttggatc
agtcattacgaaacaatgtacgacaccgccgggggcgtcaacttacccaagattactacc
tgctgtggcagtaatgggactaggtacaaacaattggtagaaggggatgatgatctacgg
caggacgctgtgatggagcaggtgttcgatctcgtcaatgttgttcttcgccgtgacaga
gagactcgaaagcgcaatctcaacatcagggcctataaggtcatcccgttagaggtacaa
gccggcatcattgaattcgtgggcaacacctcccctctcgttagctggctcctaaaagcc
cacccaaagtataaccctacggacatctcacgagaagaattctacaaaaaaatgtatgaa
ttgcgtgagaaatacaaaagggattctaccgtcaattccaggctgattgcgctgttcgcc
gagctgaagctccgcttcagaccggtgatgcggcactacttcacggaaaagcacaagctc
ccaatgtcttggtttgccatgcggttgaactacacgcgaagtgttgcgacgacctccatc
gtgggccatattctcgggcttggtgatcggcatacgtcaaatattctcatggacaatgcc
accggtgaagttgtcccgatagatctcgggatagcctttgagcaaggcaaactcctccca
atacctgaattagtaccctttcgaatgaccccggatatggttgatggcatgggaacttcg
ggaactcaaggcgtgttccagcgctgcgcagaagagacgttgcgtgttctacgggaaggg
tcggaggtcatcctcacggtcctagaagtgttcaaatacgacccgcttcactcgtggacg
gcgaccgaaatgaaattgaagcgcgtccagggcggcaccaccggcacagcgcagcaacaa
cccacccacgaccagacacatctgggaatcggcatcgacatgagcagcggtggcgtcgac
gaggcggcggaccgtgcgctgacatccgtcgcgcgcaagctggacaagtcgctcagcgtc
gagtacactgtcaatgagttgctggcagaggcgacagatcccgccaacttggcgtgcatg
ttcatcggtatgtctgcatga

DBGET integrated database retrieval system