KEGG   Heterobasidion irregulare: HETIRDRAFT_329599Help
Entry
HETIRDRAFT_329599 CDS       T03455                                 

Definition
(RefSeq) hypothetical protein
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
hir  Heterobasidion irregulare
Pathway
hir00040  Pentose and glucuronate interconversions
hir00051  Fructose and mannose metabolism
hir01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hir00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    HETIRDRAFT_329599
   00051 Fructose and mannose metabolism
    HETIRDRAFT_329599
Enzymes [BR:hir01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     HETIRDRAFT_329599
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C PspB IGFL
Motif
Other DBs
NCBI-GeneID: 20671508
NCBI-ProteinID: XP_009552445
JGI: Hetan2_329599
UniProt: W4JRP0
LinkDB All DBs
Position
Unknown
AA seq 357 aa AA seqDB search
LDTSNPAVFTNKAHDLYVEESPYPTCGDDQCIVRIRSTGICGSDIKFWRAGHVGSIIVEE
PLGLGHESAGEIVEIGKDVTKLKVGDRVAIETTIPCGTCKHCLIGRYNLCPTATSIGAPG
TPGCLRRYIAHRAAWLHLMPPDMSFATGAILEPLSVALAGIRRADLRLGQPALIAGTGAV
GLLAVALANAAGATPIVATDISQPRLEIAKKLGAKYVVNVGGKSPAEVVKEIVSLTGEAD
RPEVAIECSGIESSIQSAMLAVDAGGVVLQIGVCGKEHVAIPFGAVMDREIDLRYLFRYK
STWPAAIRLASTGKLNLEALISHTFSLEDCIKAFETVLDPHSGAVKVIVSPHSATLN
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
ttagacacctcaaatccggctgttttcactaacaaggcccatgacctgtacgttgaagaa
tcaccgtatccaacatgtggcgatgaccagtgtatcgtgcgcattcgttcgacaggtatc
tgcggctcggacatcaaattctggcgcgcaggacacgtcggttccatcatcgtcgaagag
cctctcggtctcgggcacgagtccgcgggcgaaatcgtcgagatcggaaaggatgtgaca
aaattgaaagtcggagatcgcgtcgccatcgagactacgatcccgtgcgggacgtgcaaa
cactgcctgatcggacgatacaacctctgcccaactgccacgtccatcggggcgcctggg
acgccaggttgtctacggcggtacatcgcgcaccgggcggcctggctacacttgatgcct
cccgatatgagctttgccacgggggccatcctcgaaccgctctctgttgcgcttgcaggt
atccgccgcgccgacctccgtctcggacaacctgccttgatcgccggtacgggcgccgtt
ggcctgctcgcggtcgcgctcgccaatgcagcgggtgcgacaccaatcgttgccacggat
atctcgcagcctcggctagaaatcgcaaagaagttgggtgcaaagtacgttgtcaatgtc
ggcggcaagagcccagcagaagtcgtgaaggagattgtaagcctcactggcgaagcagat
agaccagaggtcgctatcgagtgctctggaatcgagtcatctattcaatcggcgatgctg
gcggtagatgcaggtggggtcgtccttcaaataggtgtatgtggtaaggagcacgttgcg
atccccttcggcgccgtcatggatcgggagattgatctccgttacctcttccgttacaag
tcgacgtggccggccgcgatccgcctcgcctccacgggcaagctgaaccttgaggcgctc
attagccacacatttagcctcgaagactgcatcaaagcattcgagactgtcttagacccc
cactctggtgctgtcaaagtgatcgtgagtccacattctgcaactttgaattga

DBGET integrated database retrieval system