KEGG   Heterobasidion irregulare: HETIRDRAFT_379356Help
Entry
HETIRDRAFT_379356 CDS       T03455                                 

Definition
(RefSeq) hypothetical protein
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
hir  Heterobasidion irregulare
Pathway
hir00020  Citrate cycle (TCA cycle)
hir00190  Oxidative phosphorylation
hir01100  Metabolic pathways
hir01110  Biosynthesis of secondary metabolites
hir01130  Biosynthesis of antibiotics
hir01200  Carbon metabolism
Module
hir_M00009  Citrate cycle (TCA cycle, Krebs cycle)
hir_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
hir_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:hir00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HETIRDRAFT_379356
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    HETIRDRAFT_379356
Enzymes [BR:hir01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     HETIRDRAFT_379356
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA Thi4 Pyr_redox_2 FAD_binding_3 Lycopene_cycl DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 20671967
NCBI-ProteinID: XP_009542285
JGI: Hetan2_379356
UniProt: W4KHV4
LinkDB All DBs
Position
Unknown
AA seq 638 aa AA seqDB search
MLRKSLSKALNRSRAFHSSAPARRVVATNPVKAEEVKSWASGKYPLIEHEYDAIVVGAGG
AGLRAAFGLAEAGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSD
WLGDQDAIHYMTREAPNTVIELEHYGVPFSRTKEGKIYQRAFGGQSLKFGKGGQAYRCAA
AADRTGHALLHTLYGQSLRHNTNFFIEYFALDLIMQDGECVGVIALNMEDGTLHRFRAHK
TVLATGGYGRAYFSCTSAHTCSGDGNAMVARAGLPLQDLEFVQFHPTGIYGAGCLITEGS
RGEGGYLLNSEGERFMERYAPTAKDLASRDVVSRSMTIEIREGRGVGPDKDHIYLQLSHL
PPEVLHERLPGISETAAIFSGVDVTKEPIPVLPTVHYNMGGIPTKYTGEVITSDENGKDK
VVPGLYAAGEAACVSVHGANRLGANSLLDIVVFGRACAHHIKETLTPGKPHKKINDEAGI
ESIEFLDKIRTSDGPDPTAKIRLAMQKAMQSDAAVFRTQSTLDEGVGKIKEIYKTFDNVG
IKDRSMIWNSDLVETLELRNILQNAVQTITAAAARKESRGAHAREDYPERDDENWMKHTL
TWQRDVNSPEVDIKYRGVISTTLDENECKSVPPFKRVY
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atgctcagaaaaagcttgtcgaaggctttgaaccgctcgcgcgcgttccacagctcggca
ccggctcggagggtcgtagcgaccaacccggttaaggccgaggaggtcaagtcatgggca
tcaggaaagtatcccttgattgagcatgagtacgacgccattgttgttggtgctggtggt
gctggtcttcgagcagccttcggccttgcggaagcaggtttcaacacggcctgcatcacg
aagctgttccctacaagaagtcataccgtcgctgcgcagggagggattaacgctgctctc
ggtaacatgaccgaggatgattggagatggcacatgtatgacaccgtcaaaggttctgac
tggctcggtgaccaagatgctattcactacatgacccgagaagctcctaataccgtgatc
gagctcgagcactacggcgtccccttctcccgaacgaaggaaggcaaaatctaccagcgc
gccttcggtggacagtccctgaaattcggcaaaggcggtcaagcttatcgctgcgccgcc
gccgccgaccgcacaggccatgcgctgctacacacgctttatggccaatctctccgccac
aacacaaacttcttcatcgagtactttgctcttgacttaattatgcaagacggcgagtgc
gttggcgttatcgctctcaacatggaagacggtacgctgcaccgattccgcgcgcacaag
accgttctggcgactggtgggtatggacgggcatatttcagttgtacgagtgcccacaca
tgctccggtgatggtaatgccatggttgcgcgcgcgggattgccgcttcaggatttggaa
tttgtccagttccaccctacgggtatttacggtgctggatgcctgatcactgagggttct
cgaggagagggaggatatcttctcaactccgagggcgagcgtttcatggagcgctatgct
ccgactgccaaggatcttgcgtctcgcgatgtcgtctcgcgttcgatgacgattgagatc
cgcgagggccgcggtgttggtcctgacaaggatcacatctacctccagctcagccacttg
cctcctgaggtccttcacgagcgcctgcctggtatttcggagacggctgcaatcttcagc
ggtgtcgatgtcacgaaggagccgattcctgtgttacctaccgtgcactacaacatgggt
ggtatcccaacaaagtacaccggtgaggtaataacttcggacgagaacggtaaagacaag
gttgtccccggtctttatgctgctggtgaggccgcttgtgtctctgtacacggcgcgaat
cgtctcggcgccaactctctcctggacatcgtcgtcttcggccgcgcttgcgcccaccac
atcaaagagaccctcactcctggcaagccgcacaagaagatcaatgacgaggccggtatc
gagtctatcgaatttttggacaagatcaggacctcggacggtcccgacccaacagcgaag
atccggctggcgatgcagaaggccatgcaaagtgatgccgctgtgttcaggacccagtcc
acgcttgacgagggtgtcggcaagatcaaggagatctacaagacctttgataatgtcggc
atcaaggataggagcatgatctggaactctgatctcgttgagacccttgaactccgcaac
atcctccaaaacgccgtccagacgatcactgccgctgccgcccgcaaggagtcccgtggc
gcgcacgcccgcgaggactaccccgagcgcgacgacgagaactggatgaagcacaccctc
acgtggcagcgcgacgtcaactcgcccgaggtcgacatcaagtaccgcggcgtcatcagc
acgacgctcgacgagaacgagtgcaagtccgtgccgccgttcaagcgcgtgtactaa

DBGET integrated database retrieval system