KEGG   Heterobasidion irregulare: HETIRDRAFT_39327Help
Entry
HETIRDRAFT_39327  CDS       T03455                                 

Definition
(RefSeq) glycoside hydrolase family 15 protein
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
hir  Heterobasidion irregulare
Pathway
hir00500  Starch and sucrose metabolism
hir01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hir00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    HETIRDRAFT_39327
Enzymes [BR:hir01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     HETIRDRAFT_39327
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_15
Motif
Other DBs
NCBI-GeneID: 20672493
NCBI-ProteinID: XP_009552485
JGI: Hetan2_39327
UniProt: W4JRN8
LinkDB All DBs
Position
Unknown
AA seq 554 aa AA seqDB search
MVIKLTGELARTTMHFPLLFATAFFASDVVAARIILSPVDDYINKQYPLSKKLLLGNIGQ
PVGAAPGVTGVAEASNTNPLVKFTWVRDSAMVFKALVDEFTLGTDDSLRGIIDEFSLAQV
RMQHTENPAGSVSTGGLAEVKFSLDLKPDTGTWSRPQNDGPPLRANILISYAEWLLAGKN
TSFVEQVLWPSISLDIDHVINHWNEPSFELWEIVWTDSYWTAAMQARAVYTAFSLGRKLG
YDEQVNRWEAVAASILCFMQSFWKEKEGIVASTTVRDRSGVDSATVLASIYNWDPAAGCD
PLTLQPCSDRALANLKAVVDGFRSYPINPKEGAAAIGLWTEDQIYFHPWYLATFGVAEQL
YDALMSWDRAGEITVTSTSQPFFRQFVSGIRASTFKKGNPTYRKIVAGVQEFADNTIMIA
AKYTGAGGSLPQQFHNQTGEPVGASGLSWSYSASVTAFNARRGQRPVSWGAKGLVRAAAS
SCNGNVAAAGHEGVGHSEDIEGVFSNDEINLLEGLYREAEVANERYYTYNQGSLFEKVYR
EGKGFVMNYLADYY
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atggtgataaaattgaccggagagcttgctcgaacaactatgcatttccctctgcttttt
gctaccgcattctttgcgagcgatgtggtcgctgcccgtatcattctctctcccgtcgat
gactatatcaacaaacagtaccccctctcgaagaaattgctcctgggcaacataggccaa
cccgtcggtgctgcccctggtgtgaccggggtcgctgaggcgagcaacaccaaccccctc
gtcaagttcacatgggtccgggactcagcgatggtgtttaaagccctcgtcgatgagttt
acactgggcaccgacgactctttgagaggcatcatagacgaattctcccttgcccaggtt
agaatgcagcacaccgaaaatccagccggctcagtctccactggtgggcttgctgaggtt
aaattcagcctcgaccttaagcccgacactggaacttggagccgcccacagaatgatggt
ccgcccctgcgtgctaatatcttgatttcctacgcggaatggctcttagcgggcaagaac
acgtcctttgtggagcaagtcttgtggccgagcattagcctcgacatcgaccatgtgatc
aatcattggaacgagccatcctttgagctgtgggagatcgtttggacggactcatactgg
actgctgctatgcaggctcgtgctgtgtatacagcattcagccttggccgcaagttagga
tacgacgaacaggtcaatcgttgggaggctgtagcagcgagcattttgtgtttcatgcag
tccttctggaaagaaaaagagggcattgtggctagcactacagttcgggaccgctctggt
gtcgactctgccacagttctcgcctctatctacaactgggatcctgcagctggatgtgat
cctctcacgctccagccttgctcagacagagccttggcaaatctcaaagctgttgtagat
ggcttcagatcttacccaatcaacccgaaggagggagctgcagctatcggcctctggacc
gaagatcaaatttacttccatccctggtacctggccaccttcggggtcgcagaacagtta
tacgatgcactcatgtcttgggatcgcgccggagaaattactgtgacatcgacatctcag
ccattcttccgccaattcgtgtcaggcatcagagcctcgactttcaagaaaggaaatccg
acttataggaagattgtggctggtgtacaagaattcgccgataacaccatcatgattgcg
gccaagtacaccggcgccggcggttcgctgcctcaacagttccacaatcaaactggcgaa
cccgttggtgcatcaggtttgtcttggagctacagcgcctctgtgaccgcgttcaacgct
cgcagaggccaacggcctgtctcgtggggggccaagggcctcgtgcgcgccgcggcgagc
agctgcaatggcaatgttgccgcggctgggcatgaaggtgtgggacacagtgaggatata
gagggcgtttttagcaacgacgagataaacttgttggaaggtctctaccgggaagctgaa
gtcgctaacgagcgatactacacatataatcaggggtctttgttcgagaaggtttatcgg
gagggcaaaggttttgtgatgaattatttggctgactattactga

DBGET integrated database retrieval system