KEGG   Heterobasidion irregulare: HETIRDRAFT_408174Help
Entry
HETIRDRAFT_408174 CDS       T03455                                 

Definition
(RefSeq) hypothetical protein
  KO
K05351  D-xylulose reductase [EC:1.1.1.9]
Organism
hir  Heterobasidion irregulare
Pathway
hir00040  Pentose and glucuronate interconversions
hir01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hir00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    HETIRDRAFT_408174
Enzymes [BR:hir01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.9  D-xylulose reductase
     HETIRDRAFT_408174
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 AlaDh_PNT_C Glu_dehyd_C Methyltransf_25 PrmA UDPG_MGDP_dh_N Methyltransf_11
Motif
Other DBs
NCBI-GeneID: 20672666
NCBI-ProteinID: XP_009543621
JGI: Hetan2_408174
UniProt: W4KFR4
LinkDB All DBs
Position
Unknown
AA seq 375 aa AA seqDB search
MTSNPSFVLQGIEKVTYEERPIPEIKDDEVLVEVKKTGICGSDVHYLVHGRIGDFVVDGP
MVLGHESSGIINKVGKKVTRVKIGDRVAMEPGASCRTCDDCKSGRYQLCADMAFAATPPY
DGTLARYYRLPADLVYALPDHLTLEDGAMMEPLAVAVHSVSTLAGFKPNQAVAVFGCGPV
GLLCMAVAKALGASRVVAVDIVPARLEFAKTYAATETFLPPAPESGESKITYSKRSAALM
KAQLGIEERGEKAIDLVLDASGAEVSIQTGLFIVKIGGTFVQVGMGQPEVTVPIGLFLSK
EITIKGSFRYGSGDYRLAIALAAQGRIDLKPMVTHRFAFNDAVAAFKATRAGKTEDGKSL
IKAIISGPDVPVDSL
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgacatccaacccatcatttgtacttcaaggcattgaaaaggtcacctacgaggagcgg
cctatcccagagataaaggacgacgaggtgctcgtcgaagtcaagaagactggcatatgc
ggatctgatgtccactacctggttcatgggcgcattggtgattttgttgtcgacggcccc
atggtccttggacacgaatcctcgggaatcatcaacaaagttggcaagaaggtgacgagg
gtcaagattggagaccgagtggctatggagcctggtgcatcatgtcgcacctgtgatgac
tgcaagagcggtcgctaccagctgtgcgccgatatggctttcgccgctactcctccttac
gatggaaccttggcccgatactaccgcttgcctgccgaccttgtctatgctcttccagac
catttgacccttgaggatggtgcgatgatggagccactcgcagtagccgttcattcagtt
tccactttggctggattcaagcccaatcaggccgttgctgttttcggctgtgggcctgtt
gggctcctctgtatggctgtagctaaggccctcggcgcctcacgcgtcgttgcggtggat
attgtccctgctcgcttggagttcgctaaaacatatgctgctacggagacattcctacca
cccgctccggaatctggagaatcaaaaataacgtactcaaaaagatctgcagcactgatg
aaggcacagctcggcatcgaggagcgtggagagaaggcaatagaccttgtgctcgacgcg
agtggtgctgaagtctcgatccaaactggtctctttatcgtcaagatcggcgggaccttt
gttcaggttggcatgggccagcccgaggtcactgttccgattggactgtttctctcgaaa
gagatcactatcaaagggtcattccgatacggatctggtgattatcgactcgccattgct
ctcgcggctcagggtagaatcgatttgaagccaatggtcacacataggttcgcattcaac
gacgcagtcgccgcattcaaggctacaagggccggaaagactgaagatggcaaaagcctc
atcaaggccatcatctctgggcctgatgtaccggtcgattccctctag

DBGET integrated database retrieval system