KEGG   Heterobasidion irregulare: HETIRDRAFT_432658Help
Entry
HETIRDRAFT_432658 CDS       T03455                                 

Definition
(RefSeq) hypothetical protein
  KO
K15363  fanconi-associated nuclease 1 [EC:3.1.21.- 3.1.4.1]
Organism
hir  Heterobasidion irregulare
Brite
KEGG Orthology (KO) [BR:hir00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hir03400]
    HETIRDRAFT_432658
Enzymes [BR:hir01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.1  phosphodiesterase I
     HETIRDRAFT_432658
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.-  
     HETIRDRAFT_432658
DNA repair and recombination proteins [BR:hir03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   FA (Fanconi anemia) pathway
    Other FA pathway factors
     HETIRDRAFT_432658
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: VRR_NUC
Motif
Other DBs
NCBI-GeneID: 20674625
NCBI-ProteinID: XP_009542960
JGI: Hetan2_432658
UniProt: W4KKE6
LinkDB All DBs
Position
Unknown
AA seq 922 aa AA seqDB search
MSLGSPSTSLAGSLIFETQGDLTEASPTGSADENGGAMEGEKDRPHSMYVRLFEEMLHEV
ILYEHHLFTSEEISCFQAYASMDYDVQYLFIRLCLRKSDQWMRLSSFDNYRSELGDNIIS
VVKSLCAARVSDEFRVKQEELDSTNSLNASDNMDPNRAPEVKFNLFVEDQDQATLVELLQ
CLTVDELDKMAKDRKLKIRKKKDILIDCLLKSSSTQPTIDNFFTKKSDPSGSRQPSVLER
QDQRLREMVLNQLGACVRVNADIFALFRRINLVYFRCTQYTSSILTAAIVAFARKRHYFP
YIYERTWDIWPDRAALCAYERVLELEAEVDALLEGFTPSGTRSRSVLSSTPVPDLPKIEP
RDEDRVEGNETARRLAARAVAKLVFDGGIYSEWTALVAAEGHKEPRSMGLERFHHGHVLT
RIVVKGAEALHILQEFKHELDVLQALIDQPRWRRGRRGRWYDQRALILMDKFPRDDMKIA
EIALNSVLDAIDDPDVHLVYRPMLERRVLRLEKILKIPIDQRHTSENDLKKTSSISIEGV
RVHSRLEGMRLDSIGQVVANSSKTPLSQSQLPFPVKKPLFTTFKKGGLSSLEKKGDIRTE
VRTDPPSFLLREPDKFCEVQPSEKKGKSIWVGRDGEQVSVEILALQYYEGRGYKGFHTEG
RILTTLFGLLFWDVLFAPVPGAFETPYQTAPLDIAEDTFFFSREELIRARISEIQLGRAR
EILEAVDDEHREKGTWCVGVRWDLFEKQNLLEIVDCFDGKALSIICRLFCEEYAKRCSGV
PDLFLWNHERRECKFVEVKGPGDSLQENQKLWIDVLLGANVAVEVCRVSPMGQSPTKAKR
RGSPRKSKASKKAAKVESDTHTESVPGSDDEVDQFLDASQLGESIMLEPTTPSPIQPSQG
TKRHSDDDDYLPDPIKRARRSL
NT seq 2769 nt NT seq  +upstreamnt  +downstreamnt
atgtctctaggctcaccgtccacgagccttgcaggaagcctcatttttgaaactcagggg
gatcttactgaagcaagcccaactggtagcgccgacgagaatggcggcgcaatggaaggc
gaaaaagataggccgcactcgatgtatgttagattattcgaggaaatgctccacgaggtt
atattgtatgaacatcacctgtttaccagtgaagaaataagctgttttcaagcttacgcg
tctatggactacgacgttcaatatctctttatccgattgtgtctgcgaaagtcggatcaa
tggatgcgtttaagcagttttgataattaccgatctgaacttggagataacataatttct
gtcgtgaagagtctttgcgcagcgcgggtatccgatgaatttcgggtcaagcaggaggag
ctagactccaccaactctttgaatgcttcagacaacatggatcccaacagggcaccagaa
gtaaaattcaatctctttgtagaagatcaggatcaagcaacgttggttgaacttttgcaa
tgtcttaccgtggatgagctcgacaagatggcgaaggaccgcaagctgaaaattcgaaag
aagaaggatatcctcatcgattgtttgctcaagagttcctccacacagccgactatcgac
aacttctttaccaagaagtcagatcccagtggctcccgacagccttcagtgttggagcgc
caggatcaaaggctgcgtgagatggtcttaaatcagttaggtgcttgtgtgcgcgtcaac
gctgatatttttgctctttttcgacgcatcaacttggtatactttcgatgcacacaatat
acgtcaagcatccttactgcagctatcgttgcctttgcacgcaagcggcattacttccca
tacatctatgagcgcacgtgggacatttggcctgaccgcgctgcactatgtgcatatgaa
cgagttttggaactggaggctgaggtggatgcattgctcgagggattcactccttcaggc
acgcgctctaggtccgtgcttagcagtacgcctgttccagacctccccaaaatagagcca
agggacgaggacagggttgaagggaatgaaaccgctcggaggctagcggcgagagcagtg
gccaaactagtctttgatggcggtatatattctgagtggacggctttagtggctgcagaa
gggcataaggagccaaggtctatggggttggagcgctttcatcacggtcatgtcttaacg
cgcattgtggtcaagggcgctgaggcgctccacattttacaagaatttaagcacgagtta
gacgtattgcaggcgctcatcgatcaaccaagatggcgccggggacgacggggccgatgg
tatgatcagcgcgcattgattctcatggacaagtttccaagggatgacatgaaaatcgcc
gagattgctctcaattctgtgctagacgcgatcgatgacccggacgtgcatctcgtctac
cgacccatgctagagcgacgtgttcttcgtctagagaaaattctgaagatcccgatagac
caacgccatacttccgagaatgatttgaagaaaacatcatcgatatccatagagggcgtg
cgggtgcacagtcggctggagggaatgcgcctggattctattgggcaggttgttgccaat
tcctcaaagacgccgctttcgcaaagccaattacccttccctgtgaagaaacctctgttc
actacttttaagaaaggtggattatcatccttagaaaagaaaggagatataagaacggag
gtaaggacagaccctccttccttcctgttgagggagcctgataaattctgtgaggttcag
ccatcggagaagaaggggaaatcgatttgggttggaagggacggagagcaagtgagcgtt
gaaatcctcgccttgcaatactacgagggtcgcggctataaagggtttcataccgagggt
cgcatccttaccaccctcttcggcctcttgttctgggacgtcttgtttgccccggttccg
ggcgcattcgagaccccttaccagactgccccgttggatattgcagaagacacattcttc
ttttctcgtgaagagctcattcgcgcgcgaatctccgagatccaactaggcagggctcgc
gagatcttggaggctgttgatgacgaacacagggagaaggggacctggtgcgtgggagtc
cggtgggacctattcgaaaagcagaatctgctggagattgtagactgcttcgacggcaaa
gctctctcaatcatttgccggctcttctgcgaggagtacgctaagcgttgctcaggggtt
ccggatctgtttctatggaaccatgagcggagggagtgcaagttcgtcgaagtcaagggc
cctggagactcgttgcaggagaaccagaagctctggatcgacgtgcttcttggcgccaac
gtcgccgtcgaagtatgtcgcgtcagcccgatgggacagagccctacaaaagccaaacgt
cgagggagtccgcggaagtccaaagcgtccaagaaagctgccaaggtggagtcagatacg
cacaccgaatccgtaccaggctccgacgatgaggtagaccagtttttggacgcctcgcag
ctcggagagtcgataatgctcgagccgacgactccttcgccgatccagccttcccagggg
actaagagacattccgacgacgacgactacctgcctgaccccatcaaacgtgcccgaaga
tcgttgtag

DBGET integrated database retrieval system