KEGG   Heterobasidion irregulare: HETIRDRAFT_434486Help
Entry
HETIRDRAFT_434486 CDS       T03455                                 

Definition
(RefSeq) hypothetical protein
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
hir  Heterobasidion irregulare
Pathway
hir00020  Citrate cycle (TCA cycle)
hir00310  Lysine degradation
hir00380  Tryptophan metabolism
hir01100  Metabolic pathways
hir01110  Biosynthesis of secondary metabolites
hir01130  Biosynthesis of antibiotics
hir01200  Carbon metabolism
Module
hir_M00009  Citrate cycle (TCA cycle, Krebs cycle)
hir_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:hir00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HETIRDRAFT_434486
  09105 Amino acid metabolism
   00310 Lysine degradation
    HETIRDRAFT_434486
   00380 Tryptophan metabolism
    HETIRDRAFT_434486
Enzymes [BR:hir01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     HETIRDRAFT_434486
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-GeneID: 20674749
NCBI-ProteinID: XP_009547056
JGI: Hetan2_434486
UniProt: W4K5J2
LinkDB All DBs
Position
Unknown
AA seq 1001 aa AA seqDB search
MLQRNALRRLRTIASRPRLPKPPASLFLARDLATPAAAPSPNDIFANGTNAYYADEMYRH
WRQDPSSVHASWDAYFKGLDKGLGPNAFQPPPRFLPAPSDGAPSLHASGGAQLDDHLKVQ
LLVRAYQVRGHHVAELDPLGILDADLADVHPPELELSHYSFSERDLDKQITLGPGILPHF
ATEDRKTMSLGDIIKTLKRMYCGAVGIQYVHIPDKDQCDWIRERVEIPKPWNYTVEEKRM
ILDRLIWSESFEKFIASKYPNEKRFGLEGCEALIPGMKALIDRSVDHGVKHVTMGMPHRG
RLNVLANVIRKPVEAILNEFSGTTDTDPAGDVKYHLGANYVRPTPSGKKVSLSLVANPSH
LEAEDPVVLGKTRAIQHFENDELTHTTAMGVLLHGDAAFAGQGIVYETMGFHNLPSYGTG
GTIHMIVNNQIGFTTDPRFARSTPYPSDIAKSIDAPIFHVNGDNVEAVTFVCQLAADYRA
KFKKDVVIDIVCYRRYGHNETDQPSFTQPRMYKAIEKQPTPLTQYTKFLVGRGTFTEKDI
EEHKKWVWGMLETAANAAKDYVPTSKEWLSASWQGFPSPKQLAEETLPTRPTGVDESTLK
YIGKAVASYPSGFSVHRNLARILTTRGKTVEEGENIDWSTAEALAFGSLALEKTHVRVSG
QDVERGTFSQRHAVLHDQANEQQYVPLNNLGSDQARFVVCNSSLSEFGALGFELGYSLVS
PDALTIWEAQFGDFANNAQCIIDQFIASGERKWLQRTGLMMSLPHGYDGQGPEHSSARIE
RFLQLCDDHPHVFPSPEKIERQHQDCNMQIVYATTPANYFHVIRRQIHRGFRKPLINFFS
KNLLRHPKARSTLAEMTDETIFQRYIPEASADLAAPEEIRRHILCSGQVYYTLLQEREDR
GIKDVAISRLEQISPFPYDLITPHLDAYPNADILWCQEEPLNNGAWTYVGPRILTAANET
QYHRGKYPHYAGREPTSSVATGSKSQHKKEIEAFLDAAFAL
NT seq 3006 nt NT seq  +upstreamnt  +downstreamnt
atgttgcagcggaacgcgctccggcggctccgcaccatcgctagcaggcccaggctcccg
aagccccccgcatcccttttcctcgcccgcgacctcgccacccccgccgccgcgccctcc
cccaacgacatcttcgcaaacggcacgaatgcgtactacgcggatgagatgtaccgccac
tggaggcaggatccctcctcggtgcacgcgtcctgggacgcttatttcaagggcctcgac
aagggtttgggcccgaacgctttccagccccctcccaggttcttgcctgccccttcagat
ggtgcgccttccctgcacgcctctggcggcgcacagctagacgaccatctcaaggttcaa
ctgctcgtccgcgcatatcaagtgcgcggccatcatgttgccgagcttgatcccctcggc
atcctcgatgccgatctcgccgacgtccacccgccagagctcgagctcagccattacagc
ttcagcgagcgcgacctcgataagcagatcaccctcggccccggcatcctcccccacttc
gctaccgaggaccgaaaaacgatgtctttgggtgacatcatcaagaccctcaagcggatg
tactgcggtgcggtcggtatccagtacgtccacatcccggacaaagatcagtgcgactgg
atccgcgagcgcgtggaaatacccaagccatggaactataccgtagaggagaagcgcatg
atcctcgaccgcctcatctggtccgagtccttcgagaagttcatcgcgagcaagtacccc
aacgaaaagcgcttcgggctcgagggctgcgaggccctcatccctggtatgaaggccctc
atcgatcgctctgtcgaccacggtgtaaagcacgtcaccatgggcatgccccaccgtggt
cgcctcaacgtcctggccaacgtcattcgcaaacccgtcgaggctatcctgaatgagttt
tcaggaaccacggacacggacccggctggtgacgtcaagtaccacctcggcgccaactac
gtccgcccgaccccgtccggaaagaaggtctcgctctctctcgtcgccaacccgtcccat
ctcgaggcggaggaccccgtcgtgctcggcaagacacgcgcaatccagcactttgagaac
gatgagctgacgcacaccacggccatgggcgttctcctgcacggtgatgctgcgttcgcg
ggacagggcatcgtctacgagaccatgggcttccacaaccttccttcgtacggcaccggc
gggaccatccacatgatcgtcaacaaccagatcggcttcaccacggacccccgcttcgcc
cgctccacgccttacccgtccgacatcgccaagtccatcgacgcgcccatcttccacgtc
aacggcgacaatgtcgaggccgtcaccttcgtctgccagctcgccgccgactaccgcgcc
aagttcaagaaggacgtcgtgatcgacatcgtgtgctaccgccgctacggacacaacgag
acggaccagccgagcttcacccaaccgcgcatgtacaaggccatcgagaagcagccgacg
ccgctgacgcagtacacgaagttcctcgtcggccgcggcacgttcacggagaaggacatc
gaggagcacaagaagtgggtctggggcatgctcgagaccgcggcgaacgccgccaaagac
tacgtccccacgagcaaggaatggctgtccgcgtcctggcagggcttcccgtccccgaag
cagctcgcggaagagacgctcccgacgcgccccaccggcgtcgacgagtcgaccctgaag
tacatcggcaaggcagtcgcatcgtacccgtccggcttcagcgttcaccgcaacctcgcg
cgcatcctcaccacccgcggcaagaccgttgaggagggcgagaacatcgactggtccacc
gccgaggcactcgcgtttggctcgctcgcgctcgagaagacgcacgtgcgcgtgtccggg
caggacgtcgagcgcggcacgttctcgcagcgccacgcggtgctacacgaccaggcgaac
gagcagcagtacgtcccgctgaacaacctcggctcggaccaggcgcgcttcgtcgtctgc
aactcgtcgctgtccgagttcggcgcgctcgggttcgagctcggctactcgctcgtctcg
cccgacgcgctcacgatctgggaggcgcagtttggcgactttgcgaacaacgcgcagtgc
atcatcgatcagttcatcgcctccggcgagcgcaagtggctccagcgcaccgggctcatg
atgagtctcccccacggctacgacggccagggcccggagcactcgagcgcgcgcatcgag
cgctttttgcagctctgcgacgaccacccgcacgtgttccccagccccgagaagatcgag
cgccagcatcaggattgcaacatgcagatcgtctacgccaccacgcccgccaactacttc
cacgtcatccgccgccagatccaccgtggcttccgcaagccgcttatcaacttcttctcg
aagaacctcctgcgccaccccaaggcgcgctcgaccttggcggagatgaccgacgagacg
atcttccagcggtacatccccgaggcttcggcagacctcgctgcgcccgaggagattcgg
cgccacatcctctgctctggccaggtgtactacacccttctgcaggagcgcgaggacagg
ggtatcaaggacgtcgcgatcagcagactcgagcagatctcgcccttcccatacgacctg
atcacgccccatctagacgcctacccgaacgccgacatcctctggtgccaggaggagccg
ctgaataacggcgcgtggacgtacgtcgggccgcgcatcctgaccgccgcgaacgagacg
cagtaccacaggggcaagtacccgcactacgccgggcgcgagcccaccagctccgtcgcc
accggcagcaagtcccagcacaagaaggagatcgaggcgttcctcgacgccgcgttcgcc
ttgtga

DBGET integrated database retrieval system