KEGG   Heterobasidion irregulare: HETIRDRAFT_60818Help
Entry
HETIRDRAFT_60818  CDS       T03455                                 

Definition
(RefSeq) glutamate decarboxylase/sphingosine phosphate lyase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
hir  Heterobasidion irregulare
Pathway
hir00250  Alanine, aspartate and glutamate metabolism
hir00410  beta-Alanine metabolism
hir00430  Taurine and hypotaurine metabolism
hir00650  Butanoate metabolism
hir01100  Metabolic pathways
hir01110  Biosynthesis of secondary metabolites
Module
hir_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:hir00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    HETIRDRAFT_60818
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    HETIRDRAFT_60818
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    HETIRDRAFT_60818
   00430 Taurine and hypotaurine metabolism
    HETIRDRAFT_60818
Enzymes [BR:hir01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     HETIRDRAFT_60818
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-GeneID: 20678523
NCBI-ProteinID: XP_009541854
JGI: Hetan2_60818
UniProt: W4KKF2
LinkDB All DBs
Position
Unknown
AA seq 542 aa AA seqDB search
MSLSKHVNPEHLIQQSKDKPLHAHHLTKSDTTSLSYGARYGTSSVPKYKIPSTGIDAESS
YQLIHDELSLDGSPLLNLASFVHTWMPAAADRLMQENMSKNLIDQDEYPMTQAIHTRCIS
ILSDLWHAPPAHQAIGTATTGSSEAVQLGGLAMKRIWQEKRKVAGKSIHEPGPNIVMGAN
AQVALEKFARYFEVEMRLVPVSATSKYRLDPVKAMEYVDENTIGVYVILGSTYTGHYEPV
KEMADLLDEYEAKTGNNVPIHVDGASGAFVAPFATPKLVWDFKIPRVVSINTSGHKFGLA
YVGVGWVVWRSQKYLPKDLIFELHYLGSVEYSFSLNFSRPAAPIIAQYFNFLHLGFEGYR
RVALNGLANARTLSRALERSGYYTVLSDIHRYAQGGSLMGAAKTVGAVDEANNYIPGLPV
VSFRFSDKFKEKHPDLQQRWIQTLLRSRGWIVPNYELPPAMETVEILRVVVRENLTEVLI
DRLVADLIEITESLANDDSPTHALTSLGDQKHRSTTHEESHGKVDGDMIGVPKYSGTYAK
PC
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgtctctctccaagcatgtcaatccagaacatctaatacagcagtccaaggacaagccg
ctccacgcacatcacttaacaaagtcagatacaacctccttgtcttacggcgctcgttat
gggacatcttctgttccaaaatacaaaatcccctccacgggaatcgacgctgaatccagt
taccaactcattcatgacgagctctctctcgatggttctcctcttttgaacttggcgtcg
tttgtacacacatggatgcctgccgctgctgacaggttgatgcaagagaacatgtctaag
aacctgattgatcaggacgaatacccgatgacgcaggcaatccatactcgctgtatctct
attttgagtgacttatggcatgcgccaccggctcaccaggccataggtacagctacgact
ggctcatctgaagctgttcaactcggtgggctcgccatgaaacgtatttggcaggaaaag
cgcaaagtagccggcaagtctattcatgagccaggaccgaacatcgtcatgggtgcgaat
gctcaggttgcccttgaaaagtttgcgcgctatttcgaagttgagatgcgtttggttcct
gtatctgccacgagcaagtacaggcttgacccagtgaaagctatggaatacgttgacgag
aacacgatcggcgtgtatgtcatcttgggcagcacttacactggccactacgaacctgta
aaagagatggccgatctcctagacgaatatgaggccaagacaggcaacaatgtgcccatt
catgtcgatggtgcatctggagcatttgttgctccttttgccacgcccaagcttgtctgg
gattttaaaattcctcgtgtcgtctccatcaacacatccggccacaaattcggtctcgcc
tacgttggcgtcggttgggttgtctggcgctcccaaaaatacctcccgaaagaccttatt
ttcgagctccactacctcggttctgtcgaatattccttttcgctcaacttctcccgtccc
gcagcccccatcattgcgcagtatttcaatttcctgcacctcggatttgaaggctatcga
agggtcgctctaaatggcttagccaatgcgcgcacgctttcacgcgcactcgagcgctct
gggtattatacagtgctgagtgacattcatcggtatgcgcaaggaggaagcctgatgggt
gctgcgaagacggttggtgctgtcgatgaagcgaataactatattcctggtttgccggtc
gtatctttccggttctctgacaaattcaaagagaaacatcctgatttgcagcaaagatgg
atccagaccctcctgcggtcgagaggatggattgtccccaactatgaacttcccccggct
atggagacagtggagatcctccgtgtcgttgtaagagaaaatttgactgaggtccttatc
gatcgccttgttgcggatcttatcgagatcactgagtcacttgcgaatgacgactccccg
acccacgcgttaacttctcttggggaccaaaagcatcgatccacgactcatgaggaaagt
cacggtaaagttgacggtgacatgattggtgtccccaaatactctggcacatatgccaaa
ccgtgttga

DBGET integrated database retrieval system