KEGG   Heterobasidion irregulare: HETIRDRAFT_65781Help
Entry
HETIRDRAFT_65781  CDS       T03455                                 

Definition
(RefSeq) glycoside hydrolase family 13 protein
Organism
hir  Heterobasidion irregulare
SSDB OrthologParalogGFIT
Motif
Pfam: CBM_20 Alpha-amylase Alpha-amylase_C
Motif
Other DBs
NCBI-GeneID: 20678754
NCBI-ProteinID: XP_009551196
JGI: Hetan2_65781
UniProt: W4JS51
LinkDB All DBs
Position
Unknown
AA seq 545 aa AA seqDB search
MFEWTWDSIAAECTNFLGPAGYGFVQASPAAEHISGSQWWTDYQPVSYILTSKRGNRSQY
KNMIDTCHAAGVGVIADTIFNHMAGMDSGTGVAGSSFTHYNYPGIYQTQDFHHCGLEPGD
GIVNYDNRLEVQTCQLDNLADLATDTEYVRERLAQYANDLLSLGVDGLRLDAAKHIAATD
IANITSRFNSAPYITQEVIWGSGEPIQPSEYTGIGDVQEFRYTTALQDAFSSSGISGLQN
LDSNGWVSGSGANVFVADHDTERNGNSLNANSPSNTYYLAHIFSLAHPYGTPTVLSSYSG
FSDTDVGAPNSGVGTCSGSTGTNGWLCQHRWTGIAGMVGFRNNVSSAALNNWVAPSSQQI
AFGRGSIGFVAINNVDSSWTATFTSSLPAGTYCDVVSGGSSSGNCTGSSFTVSSSGTFAA
TIGSRSAIAIHTGATGTGTGSGSTSPTNSTIAVTFQETATTTYGENIFLVGSISQLGDWA
AASAIALSSANYPTWSVTVNLPASTTFQYKFIRKETDGSVNWESDPNRSDTTPSSGTQTI
TTSWR
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atgttcgagtggacatgggacagcattgctgctgagtgcacgaacttccttggtccagca
ggttacggttttgtacaagcgagccctgccgccgagcatatcagcggtagccaatggtgg
acggattatcagcccgtttcctatatcctgacatcgaagcgagggaatcgttctcaatat
aagaacatgatagacacttgccatgcggctggtgtcggggtcattgctgacacgatcttc
aaccatatggctggaatggactctgggactggagtggctggaagcagcttcacgcactac
aactaccccggtatttatcagacgcaggacttccatcactgtggactcgagccaggagat
ggaattgtcaattatgataaccgtctggaagtgcagacctgccaattggacaacttggcg
gatttggcgaccgacacagaatacgttcgcgaacgactggcacaatatgctaatgatcta
ttaagcctcggtgtcgatggcctgcgtttggatgctgctaaacatatcgccgcaacggat
attgcgaatatcacgtcgcgcttcaattcggctccatacatcacccaagaggtcatttgg
ggatcaggagagcctattcaaccctctgaatacactgggatcggcgatgtccaagagttc
cgttacactacggctctccaagatgctttctccagctcgggaatctctggtctacaaaat
ttggatagcaacggttgggtttctggctcgggagccaacgtttttgtcgccgaccatgat
accgagaggaatggcaactcactgaacgccaattcgccctccaacacctactatcttgct
catatattctcacttgctcacccctatgggacgcctactgttttatccagctactctggg
ttctcagacaccgacgtcggcgctccgaatagcggagtaggaacgtgttcagggagcacc
ggcaccaacggctggttgtgtcaacatcggtggaccggcatcgccggcatggttggcttc
cgcaacaatgtcagttcagcggcgctcaacaactgggtggctcccagctctcaacagata
gcctttggtcgaggcagcataggtttcgtcgctatcaacaacgtggactcctcctggacc
gcaacatttacctcctcccttccagcgggaacctactgcgatgttgtcagtggggggtct
tcttctggaaactgcacgggctcttcctttactgtttcatcgagcggcacgtttgccgcg
acgatcgggtcgcgctcagcaattgcgatccacacaggcgcgactggcaccggcactgga
tctggatcgacttcaccaacaaattccaccatagctgtcacattccaggagactgcaaca
acgacttatggggagaacattttcctcgttggtagtatctctcaacttggagattgggca
gcagcgagtgcgatcgcactctcgtcggctaattatcccacttggagcgtgacggtcaac
cttcctgcgagcacgacattccagtacaagttcatccgaaaggagacggatgggagcgtc
aattgggagtctgaccccaaccggagtgacacgaccccgagctcgggtactcaaaccatc
accacctcttggcgctga

DBGET integrated database retrieval system