KEGG   Haemophilus influenzae 10810 (serotype b): HIB_05490Help
Entry
HIB_05490         CDS       T01720                                 

Definition
(GenBank) fused penicillin-binding protein 1a: murein transglycosylase/murein transpeptidase
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
hiu  Haemophilus influenzae 10810 (serotype b)
Pathway
hiu00550  Peptidoglycan biosynthesis
hiu01100  Metabolic pathways
hiu01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:hiu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    HIB_05490
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    HIB_05490
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hiu01003]
    HIB_05490
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:hiu01011]
    HIB_05490
Enzymes [BR:hiu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     HIB_05490
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     HIB_05490
Glycosyltransferases [BR:hiu01003]
 Polysaccharide
  Bacterial polysaccharide
   HIB_05490
Peptidoglycan biosynthesis and degradation proteins [BR:hiu01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   HIB_05490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase PCB_OB TarH
Motif
Other DBs
NCBI-ProteinID: CBW28737
LinkDB All DBs
Structure
PDB: 

Position
554554..557148
Genome map
AA seq 864 aa AA seqDB search
MRIAKLILNTLLTLCILGLVAGGMLYFHLKSELPSVETLKTVELQQPMQIYTADGKFIGE
VGEQRRIPVKLADVPQRLIDAFLATEDSRFYDHHGLDPIGIARALFVAVSNGGASQGAST
ITQQLARNFFLTSEKTIIRKAREAVLAVEIENTLNKQEILELYLNKIFLGYRSYGVAAAA
QTYFGKSLNELTLSEMAIIAGLPKAPSTMNPLYSLKRSEERRNVVLSRMLDEKYISKEEY
DAALKEPIVASYHGAKFEFRADYVTEMVRQEMVRRFGEENAYTSGYKVFTTVLSKDQAEA
QKAVRNNLIDYDMRHGYRGGAPLWQKNEAAWDNDRIVGFLRKLPDSEPFIPAAVVGIAKG
GADILLASGEKMTLSTNAMRWTGRSNPVKVGEQIWIRQRANGEWQLGQIPAANSALVSLN
SDNGAIEAVVGGFSYEQSKFNRATQSLVQVGSSIKPFIYAAALEKGLTLSSVLQDSPISI
QKPGQKMWQPKNSPDRYDGPMRLRVGLGQSKNMIAIRAIQTAGIDFTAEFLQRFGFKRDQ
YFASEALALGAASFTPLEMARAYAVFDNGGFLIEPYIIEKIQDNTGKDLFIANPKIACIE
CNDIPVIYGETKDKINGFANIPLGESALKPTDDSTNGEELDQQPETVPELPELQSNFTAL
KEDAIDLMAAAKNASSKIEYAPRVISGELAFLIRSALNTAIYGEQGLDWKGTSWRIAQSI
KRSDIGGKTGTTNSSKVAWYAGFGANLVTTTYVGFDDNKRVLGRGEAGAKTAMPAWITYM
KTALSDKPERKLPLPPKIVEKSIDTLTGLLSPNGGRKEYFIVGTEPTRTYLSEMQERGYY
VPTELQQRLNNEGNTPATQPQELF
NT seq 2595 nt NT seq  +upstreamnt  +downstreamnt
atgcggatcgcaaaattaatattaaacaccctattaactttatgtattttaggtttagta
gcaggcggaatgttgtatttccacctaaaatctgaattgccctcagtagaaacattaaaa
accgttgaattacaacaaccaatgcagatttatacggcagacggtaaattcattggcgaa
gtgggtgagcaacgccgtattccagtgaaattagccgatgtgccacaacgcttaattgac
gcatttttagcgacggaagacagtcgtttttacgatcatcacggattagaccctatcggc
attgcccgtgcattatttgtcgcagtgagtaatggcggtgcatcacaaggcgcaagtacg
attactcaacaattagcgcgtaactttttcttaacctcagaaaaaaccattattcgtaaa
gcccgtgaagccgtgcttgcggtagaaattgaaaatactctcaacaaacaagaaatatta
gagctttatttaaacaaaatctttttaggctatcgttcttatggtgttgcagcggcagca
caaacctatttcggtaaatcattgaatgaattgaccttatcggaaatggcgattattgct
ggtttacctaaggcaccttcaacaatgaatccgctttattcgctaaaacgttcagaagaa
cgccgcaatgtggtgctaagccgtatgttagatgaaaaatacatcagcaaagaagaatat
gatgctgcattgaaagagccgattgtggcgagctatcacggcgcaaaatttgaatttcga
gccgattatgtcactgaaatggtgcgtcaagaaatggtgcgtcgttttggcgaagaaaat
gcttacaccagtggttataaagtatttaccactgtactttcaaaagaccaagctgaagcc
caaaaagctgtgcgtaataacttgattgattacgatatgcgtcacggttatcgcggtggc
gcgccattatggcaaaaaaatgaagccgcttgggacaatgatcgcattgtcggttttcta
cgcaaactacctgattcagagccatttattcctgcggcagtggttggaattgcaaaaggc
ggtgctgatatattgctcgcttctggggaaaaaatgaccttatcaaccaatgcaatgcgt
tggacaggcagaagcaatcctgtgaaagtcggcgagcaaatttggattcgtcagcgtgct
aatggggaatggcaattaggacaaattcccgcagcaaattcagcattagtttctcttaat
tcagataatggcgcgattgaagcagtggtgggcggatttagttatgaacaaagtaaattc
aatcgagccacacaatctttagttcaagtgggttcttctattaaaccatttatttacgcg
gcagcattagaaaaaggcttaacgctttcaagcgtattacaagacagcccgatttctatt
caaaaaccgggacaaaaaatgtggcaaccgaaaaactcgcctgatcgttatgatggtcca
atgcgtttacgcgtaggattaggtcaatccaaaaatatgattgctattcgtgcgatccaa
acggcaggtattgatttcacagcagaatttttacaacgttttggttttaaacgtgatcaa
tattttgcaagtgaagccttagcacttggcgcggcctctttcacgccattagaaatggcg
cgagcttatgccgtgtttgataatggtggcttcctcattgaaccttatatcattgaaaaa
attcaagataacacgggtaaagacttatttattgcaaaccctaaaattgcttgcattgaa
tgtaatgatatacctgtaatttatggcgaaaccaaagacaaaatcaacggctttgccaat
attcctttaggcgagagtgccttaaaaccaacagatgacagcaccaatggcgaagaatta
gatcaacaacctgaaactgtacctgaactgccagaattacagtcaaatttcaccgcactt
aaggaagatgcaattgatttaatggctgctgcaaaaaatgcttcgtcgaaaatagaatat
gcaccacgtgtcattagtggcgaacttgcttttctcattcgtagtgccttaaatacagca
atttatggcgaacaaggtttagactggaaaggcaccagttggcgtatcgcacaaagcatt
aaacgtagcgatataggcggtaaaacaggtaccaccaacagttcaaaagtggcttggtat
gcaggatttggtgcaaacttagtcactacaacttatgtcgggtttgatgataacaaacgt
gtacttgggcgtggagaagcaggtgcaaaaacagccatgccagcttggatcacttatatg
aaaacggctttgagtgataagccagaacgtaaattgccactgccgccaaaaattgtggaa
aaaagcattgatactttgacaggtttgctttctccaaacggtggacgcaaagaatatttt
attgtgggaacagaaccgacacgtacctatctttcggaaatgcaagagcgtggttattac
gttcctacagagttacagcaacgcttaaataatgaaggcaatacgccagcgacgcaacca
caagaactcttctaa

DBGET integrated database retrieval system