KEGG   Haemophilus influenzae 10810 (serotype b): HIB_07040Help
Entry
HIB_07040         CDS       T01720                                 

Gene name
tuf2
Definition
(GenBank) recname: full=elongation factor tu 2; short=ef-tu 2; recname: full=elongation factor tu 2; short=ef-tu 2
  KO
K02358  elongation factor Tu
Organism
hiu  Haemophilus influenzae 10810 (serotype b)
Brite
KEGG Orthology (KO) [BR:hiu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:hiu03012]
    HIB_07040 (tuf2)
   03029 Mitochondrial biogenesis [BR:hiu03029]
    HIB_07040 (tuf2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hiu04147]
    HIB_07040 (tuf2)
Translation factors [BR:hiu03012]
 Eukaryotic Type
  Elongation factors
   HIB_07040 (tuf2)
 Prokaryotic Type
   HIB_07040 (tuf2)
Mitochondrial biogenesis [BR:hiu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    HIB_07040 (tuf2)
Exosome [BR:hiu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   HIB_07040 (tuf2)
  Exosomal proteins of breast cancer cells
   HIB_07040 (tuf2)
  Exosomal proteins of colorectal cancer cells
   HIB_07040 (tuf2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW
Motif
Other DBs
NCBI-ProteinID: CBW28892
LinkDB All DBs
Position
complement(705199..706383)
Genome map
AA seq 394 aa AA seqDB search
MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKHYGGAARAFDQIDNAPEEKARG
ITINTSHVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHI
LLGRQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLSQYDFPGDDTPIVRGSALQALN
GVAEWEEKILELANHLDTYIPEPERAIDQPFLLPIEDVFSISGRGTVVTGRVERGIIRTG
DEVEIVGIKDTAKTTVTGVEMFRKLLDEGRAGENIGALLRGTKREEIERGQVLAKPGSIT
PHTDFESEVYVLSKDEGGRHTPFFKGYRPQFYFRTTDVTGTIELPEGVEMVMPGDNIKMT
VSLIHPIAMDQGLRFAIREGGRTVGAGVVAKIIK
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaagaaaaatttgaacgtacaaaaccgcacgtaaacgtgggtacaatcggccac
gttgaccacggtaaaacaactttaacagcagcaatcacaaccgtattagcaaaacactac
ggtggtgcagcgcgtgcatttgaccaaattgataacgcgccagaagaaaaagcgcgtggt
attaccatcaacacttcacacgttgaatacgatacaccgactcgtcactacgcacacgta
gactgtccgggacacgccgactatgttaaaaatatgattactggtgcggcacaaatggat
ggtgctattttagtcgtagcagcaacagatggtcctatgccacaaactcgtgagcacatc
ttattaggtcgccaagtaggtgttccatacatcatcgtattcttaaacaaatgcgacatg
gtagatgacgaagagttattagaattagtagaaatggaagttcgtgaacttctatctcaa
tatgacttcccaggtgacgatacaccaatcgtacgtggttcagcattacaagcgttaaac
ggcgtagcagaatgggaagaaaaaatccttgagttagcaaaccatttagatacttacatc
ccagaaccagaacgtgcgattgaccaaccgttccttcttccaatcgaagatgtattctca
atctcaggtcgtggtactgtagtaacaggtcgtgtagaacgtggtatcatccgtacaggt
gatgaagtagaaatcgtcggtatcaaagatacagcgaaaactactgtaactggtgttgaa
atgttccgtaaattacttgacgaaggtcgtgcaggtgaaaacatcggtgcattattacgt
ggaaccaaacgtgaagaaatcgaacgtggtcaagtattagcgaaaccaggttcaatcaca
ccacacactgacttcgaatcagaagtgtacgtattatcaaaagatgaaggtggtcgtcat
actccattcttcaaaggttaccgtccacaattctatttccgtacaacagacgtaactggt
actattgaattaccagaaggcgtggaaatggtaatgccaggggataacatcaagatgaca
gtaagcttaatccacccaattgcgatggatcaaggtttacgtttcgcaatccgtgaaggt
ggccgtacagtaggtgcaggcgttgttgcgaaaatcatcaaataa

DBGET integrated database retrieval system