KEGG   Haemophilus influenzae 10810 (serotype b): HIB_13140Help
Entry
HIB_13140         CDS       T01720                                 

Definition
(GenBank) fused cysteine transporter subunits of ABC superfamily: membrane component/ATP-binding component
  KO
K16012  ATP-binding cassette, subfamily C, bacterial CydC
Organism
hiu  Haemophilus influenzae 10810 (serotype b)
Pathway
hiu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:hiu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    HIB_13140
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hiu02000]
    HIB_13140
Transporters [BR:hiu02000]
 ABC transporters, eukaryotic type
  ABCC (CFTR/MRP) subfamily
   ABCC-BAC subgroup
    HIB_13140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran ABC_membrane SMC_N AAA_21 DUF87 AAA_22 RsgA_GTPase AAA_16 MMR_HSR1 T2SSE AAA_29 AAA_18 FtsK_SpoIIIE AAA_23 DUF815 Metallophos_3 NACHT AAA_7 Roc ATP-synt_ab
Motif
Other DBs
NCBI-ProteinID: CBW29501
LinkDB All DBs
Position
complement(1353476..1355206)
Genome map
AA seq 576 aa AA seqDB search
MRTLLPFIRLFKFAKFPLILGLVLMILGLGSSMSLLTVSGWFLAATAIAGLGTLFNFFYP
SASVRGLAIGRTVMRYFEKIVTHDATFRILSKLRVQVFEKIIPLSPAVLNRYRNSDLLNR
LVSDVDTLDSLYLRLLAPFFTAVFVIIAITIGLSFINISLALGLGLFLLILLIIIPTVFY
RLGQQFGERLIQARATYRTQFLEFIQAQAELLLFNAEDRLKEKMSVTEKTWQEDQAKEAK
LNGFSTALVLFLNGLLISGMLWFASNADFGTDEYRTAYIALFTFAALAAFEIIMPLGAAF
LHIGQVIAAAERVTEIIEQKPLVEFNGNEEFETKVRLISAKNLNFSYPEQETLVLKNLTL
DLEQGQKIAILGKTGSGKSSLLQLLVRNYDANQGELLLAEKPISAYSEETLRRQICFLTQ
RVHVFSDTLRQNLQFASADKISDEKMIEVLHQVGLSKLLEQEGKGLNLWLGDGGRPLSGG
EQRRLGLARILLNNAPILLLDEPTEGLDRETERQILRLILQHADNKTLIIVTHRLSSIEQ
FDKICVIDNGRLIEEGDYNSLITKENGFFKRLIERV
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atgcgcacattacttccgtttatacgtttatttaaattcgccaaatttcctcttatttta
ggcttggtgctgatgattttaggattgggatccagcatgagcttgcttaccgtttcaggc
tggtttttagccgctacagccattgcaggactaggcacgctatttaactttttctaccct
tcagccagtgtgcgaggtttagctatcggacgaaccgtcatgcgctattttgaaaaaata
gtgacgcatgatgcaacattccgcattttgtcgaaattacgcgtacaagtatttgaaaaa
atcattcctttaagcccagcggtattaaatcgttatcgtaacagcgatttattaaatcgt
ttagtgtccgatgtggatacccttgatagcctctatttacgtttacttgcgccatttttc
actgctgtatttgtaatcattgccataacgattggacttagctttatcaatatttcactc
gcacttggtttaggcttatttttgttaattttattaataattatcccaactgttttctat
cgactaggacagcaatttggcgaacgcttaatccaagcacgcgcgacctatcgaacccag
tttttagaatttatccaagcacaagccgagcttttattatttaatgcggaagatagatta
aaagaaaaaatgtcagtcacagaaaaaacatggcaggaagatcaagctaaagaagcaaaa
ttaaacggattctctaccgcacttgttctctttcttaatggtttgttgatttctggaatg
ctatggtttgcaagtaacgccgattttggcacagatgaatatcgcacggcttatattgca
cttttcacttttgctgcacttgccgcctttgagatcatcatgccattgggtgctgctttt
ttgcatataggtcaagtgattgctgcagcagaacgtgtgaccgaaatcattgagcaaaaa
ccgcttgttgagtttaatggtaacgaggaatttgaaacaaaagtgcggttaatttctgcg
aagaatttaaatttttcctatcccgaacaagaaacactcgtattaaaaaatcttacatta
gatttagaacaaggacaaaaaattgctattttaggcaaaactggaagtggaaaatcttca
ctccttcaacttttggtacgcaattatgatgcgaatcaaggtgagcttttattggcagaa
aaacccatttccgcctattcagaagaaacattacgccgccaaatttgttttttaactcaa
cgtgttcacgtattcagcgatacgcttcgtcaaaatttacaatttgcaagtgcggataaa
atttctgatgaaaaaatgattgaagtactacatcaagttggcttaagtaaattacttgag
caagaaggaaaaggtttaaatctttggctgggagatggcggtcgtccactttctggtggg
gaacaacgccgtttaggtttagcgcgtattttactcaataatgcgcccattttattattg
gatgaaccgacagaaggcttagatcgcgaaactgaacgtcaaattttacgtttaattctg
caacatgccgacaataaaaccctaattatagtcactcaccgtctcagttcaattgaacaa
ttcgataaaatttgtgtaattgataacggaagattaatcgaagaaggcgattacaatagt
ttaatcacaaaagaaaatgggttctttaaaagattgattgagcgagtataa

DBGET integrated database retrieval system