KEGG   Haemophilus influenzae 10810 (serotype b): HIB_18990Help
Entry
HIB_18990         CDS       T01720                                 

Definition
(GenBank) fused glycosyl transferase and transpeptidase
  KO
K05365  penicillin-binding protein 1B [EC:2.4.1.129 3.4.16.4]
Organism
hiu  Haemophilus influenzae 10810 (serotype b)
Pathway
hiu00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:hiu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    HIB_18990
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hiu01003]
    HIB_18990
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:hiu01011]
    HIB_18990
Enzymes [BR:hiu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     HIB_18990
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     HIB_18990
Glycosyltransferases [BR:hiu01003]
 Polysaccharide
  Bacterial polysaccharide
   HIB_18990
Peptidoglycan biosynthesis and degradation proteins [BR:hiu01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   HIB_18990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly UB2H Transpeptidase UvrB_inter
Motif
Other DBs
NCBI-ProteinID: CBW30084
LinkDB All DBs
Position
1943333..1945678
Genome map
AA seq 781 aa AA seqDB search
MTSQHSAKKSSKNTPKNNRTFKGFLLKFSFTALVLTIFYGGYLDWQIRSKMDGQIWHLPA
EVYSRLESVKIADNLAFDEVIQILLDNEYRQTTIVAAPGDFKLEDDSIVILRRAFPFPDK
AEPQRVLRLRFNNNKLSRIEDLVTVKTVDEFRLAPKLIAMLQSDNEDRLAIPLQNYPRLL
IDTLILTEDRRFYEHNGINPVGILRALIANIRAGQTVQGGSTLTQQLVKNLFLSRERTIT
RKANEALMSLVLDWRYDKNRILETYLNEIYLGQNGDTQIHGFELASQFYFGRSIREISLD
QIALLVGMVKGPSLYNPWRNPQNALERRNIVLKLMLEHKMIGDELYQLLSQRPLGVQKKG
QISRKYPAFIQTLQADLRRELGEHKISSLLGARIFSTMDLKQQAQAENAVVNTVSQLQLK
MKNPHLEGAMIITDYRTGEIRAVVGGLQTQYAGFNRALMAKRQIGSLVKPSIYLTALSNP
EQFRLNTPINNQPITINVKGNPPWQPRNYDKKYSDSVMLMDALARSLNIPTVNIGMKVGL
SKVIDTQKAMGWDNVEIPKVPAMLLGSYTISPYDVTKLYQTLANQGGRIALTTVDSIADR
QGNLIFQHDKSAKQVVPQEAAFQTLFAMQQTVERGTARSLQKDYADLHLAGKTGTTNESR
DTWFVGIDGKNISTVWLGRDDNGETKLTGASGALQIYKDYLNRTNIEKLTITPPTTVKWV
GINQYGDWDCESYRTIPVWLNNGQNFCGETSSPSLTPTTETETPPQESLWDVLDNPNPPA
Q
NT seq 2346 nt NT seq  +upstreamnt  +downstreamnt
atgacttctcaacactccgctaaaaaatcatcgaaaaacacgccaaaaaataaccgcact
tttaaaggttttttacttaaatttagcttcacagcacttgtcttaacgattttttacggc
ggttatctcgattggcaaattcgttctaaaatggacggtcaaatttggcatttgcctgcg
gaagtttatagtcgattagaaagtgtgaaaattgccgataatctcgcttttgatgaagtc
attcaaattttattagataacgaatatcgccaaactacaatagttgccgcacctggcgat
ttcaaattagaagatgatagcattgtaatacttcgccgcgcttttcctttccccgataaa
gcagagcctcagcgagttttacgcttgcgttttaacaataataagttatctcgcattgaa
gatttagtcacagtcaaaactgttgatgaatttcgtcttgcaccaaagttgattgcgatg
ttgcaatcagacaacgaagatcgccttgctattcctttgcaaaattatccccgtttatta
attgatacattaattttaacggaagatcgccgcttttatgaacataatggcattaatcca
gtggggattttacgtgcattaattgcgaatattcgtgcaggtcaaactgtacagggcgga
agtacgctcactcaacaattagtcaaaaatttatttttatcgcgcgaacgcaccattaca
cgcaaagccaacgaagccttgatgtcattggtgttagattggcgttacgataaaaaccga
attctcgaaacctatctcaatgaaatttatctaggacaaaatggcgatacgcaaattcac
ggttttgaattagccagccaattctattttggtcgttcgattcgtgaaattagcttagat
caaattgcccttttagtggggatggtcaaaggcccttcactttataatccgtggcgtaat
ccgcaaaacgcgctcgaacgtcgcaacattgttttaaagctaatgcttgaacataaaatg
atcggcgatgaactttatcaattattaagtcagcgacctttaggtgtgcaaaagaaaggg
caaatctcgcgtaaatatcctgcatttattcaaactttacaggcggatttacgccgcgaa
ctgggcgaacacaaaatatcaagcttacttggtgcacgtattttttccacaatggattta
aaacaacaagctcaagcagaaaatgcagtggtcaataccgtttcgcaattacaactgaaa
atgaaaaatccccatttagagggagcgatgattataacggattatcgcacaggcgaaatt
cgtgcagtagttggcggtttacaaacgcaatatgcaggctttaatcgtgcattaatggca
aaacgtcagattggttctttagtaaaaccttctatttatttgaccgcactttctaaccca
gaacagttccgtttgaataccccaattaataaccaaccaataacaattaatgtcaaaggt
aacccgccgtggcagccacgcaactatgacaaaaaatatagtgattcagtaatgttaatg
gatgccttagcccgttctttaaatattcccactgtaaatattggtatgaaagttggcttg
agcaaagtcattgacacgcaaaaagcgatgggctgggacaacgtggaaattcctaaagtg
cctgcgatgttgctcggttcttataccatctcgccttatgatgtcacaaaactttatcaa
acccttgccaatcaaggtgggagaattgcgcttacaaccgtcgatagtattgcagatcgt
caaggtaacctaatttttcaacacgataaaagtgcaaaacaagtggtgccacaagaagcg
gcattccaaaccttatttgcaatgcaacaaactgttgaacgtggtacagctcgcagtttg
caaaaggattacgctgatttacatttagcaggcaaaacaggcacaaccaatgaatcacgc
gatacgtggtttgtgggaattgacggaaaaaatatcagcaccgtctggcttggtcgcgat
gataatggcgaaacaaaactgactggtgcttctggcgcattgcaaatttataaagattat
ttaaaccgtacaaatattgaaaaattaacaattactccccctacaacagtgaaatgggtg
gggataaatcaatacggtgactgggattgtgagagttatcgaacaattcctgtttggcta
aataatggtcagaatttctgtggcgaaacatcatctccctctctcacgccaacaactgaa
acagaaacaccaccacaagaaagcctgtgggacgtattggataatcccaatccacccgct
caataa

DBGET integrated database retrieval system