KEGG   Haemophilus influenzae 477: NTHI477_01553Help
Entry
NTHI477_01553     CDS       T03720                                 

Gene name
mrcA
Definition
(GenBank) Penicillin-binding protein A
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
hiw  Haemophilus influenzae 477
Pathway
hiw00550  Peptidoglycan biosynthesis
hiw01100  Metabolic pathways
hiw01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:hiw00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    NTHI477_01553 (mrcA)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    NTHI477_01553 (mrcA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hiw01003]
    NTHI477_01553 (mrcA)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:hiw01011]
    NTHI477_01553 (mrcA)
Enzymes [BR:hiw01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     NTHI477_01553 (mrcA)
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     NTHI477_01553 (mrcA)
Glycosyltransferases [BR:hiw01003]
 Polysaccharide
  Bacterial polysaccharide
   NTHI477_01553 (mrcA)
Peptidoglycan biosynthesis and degradation proteins [BR:hiw01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   NTHI477_01553 (mrcA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase PCB_OB TarH
Motif
Other DBs
NCBI-ProteinID: AJO88523
UniProt: A0A3E1QN38
LinkDB All DBs
Structure
PDB: 

Position
1570431..1573025
Genome map
AA seq 864 aa AA seqDB search
MRIAKLILNTLLTLCILGLVAGGMLYFHLKSELPSVETLRTVELQQPMQIYTADGKLIGE
VGEQRRIPVKLADVPQRLIDAFLATEDNRFYDHHGLDPIGIARALFVAVSNGGASQGAST
ITQQLARNFFLTPEKTIIRKAREAVLAVEIENTLNKQEILELYLNKIFLGYRSYGVAAAA
QTYFGKALNELTLSEMAIIAGLPKAPSTMNPLYSLKRSEERRNVVLSRMLDEKYISKEEY
DAALKEPIVASYHGAKFEFRADYVTEMVRQEMVRRFGEENAYTSGYKVFTTVLSKDQAEA
QKAVRNNLIDYDMRHGYRGGAPLWQKNEAAWDNDRIVGFLRKLPDSEPFIPAAVIEIAKG
GADILLASGEKMTLSTNAMRWTGRSNPVKVGEQIWIRQRANGEWQLGQIPAANSALVSLN
SDNGAIEAVVGGFSYEQSKFNRATQSLVQVGSSIKPFIYAAALEKGLTLSSVLQDSPISI
QKPGQKMWQPKNSPDRYDGPMRLRVGLGQSKNMIAIRAIQTAGIDFTAEFLQRFGFKRDQ
YFASEALALGAASFTPLEMARAYAVFDNGGFLIEPYIIEKIQDNTGKDLFIANPKIACIE
CNDIPVIYGETKDKINGFANIPLGESALKPTDDSTNGEELDQQPETVPELPELQSNFTAL
KEDAIDLMAAAKNASSKIEYAPRVISGELAFLIRSALNTAIYGEQGLDWKGTSWRIAQSI
KRSDIGGKTGTTNSSKVAWYAGFGANLVTTTYVGFDDNKRVLGRGEAGAKTAMPAWITYM
KMALSDKPERKLPLPPKIVEKNIDTLTGLLSPNGGRKEYFIVGTEPTRTYLSEMQERGYY
VPTELQQRLNNEGNTPATQPQELF
NT seq 2595 nt NT seq  +upstreamnt  +downstreamnt
atgcggatcgcaaaattaatattaaacaccctattaactttatgtattttaggtttagtg
gctggcggaatgttgtatttccacctaaaatcggaattgccctcagtagaaacattaaga
accgttgaattacaacaaccaatgcagatttatacggctgacggtaaattaattggcgaa
gtgggcgagcaacgccgtattccagtgaaattagccgatgtgccacaacgcttaattgac
gcatttttagcaacggaagacaatcgtttttacgatcatcacggattagaccctatcggc
attgctcgtgcattgtttgtcgcagtgagtaatggcggtgcatcacaaggtgcaagtacg
attactcaacaattagcgcgtaactttttcttaaccccagaaaaaaccattattcgtaaa
gcccgtgaagcggtgcttgcggtagaaattgaaaataccctcaacaaacaagaaatctta
gagctttatttaaacaaaatctttttaggctatcgttcttatggtgttgcagcagcggca
caaacctatttcggtaaagcattgaatgaattgaccttatctgaaatggcgattattgct
ggtttacctaaagcaccttcaacaatgaatccgctttattcgctaaaacgttcagaagaa
cgtcgcaatgtggtgctaagccgtatgttagatgaaaaatacatcagcaaagaagaatat
gatgctgcattgaaagagccgattgtggcgagttatcacggcgcaaaatttgaatttcgt
gctgattatgtcactgaaatggtgcgtcaagaaatggtgcgtcgttttggcgaagaaaat
gcttacaccagtggttataaagtatttaccactgtactttcaaaagaccaagctgaagcc
caaaaagctgtgcgtaataacttgattgattatgatatgcgtcacggttatcgcggtggc
gcgccattatggcaaaaaaatgaagccgcttgggacaatgatcgcattgtcggttttcta
cgcaagctacctgattcagagccatttattcctgcggcagtgattgaaattgcaaaaggc
ggtgctgatatattgctcgcttctggggaaaaaatgaccttatcaaccaatgcaatgcgt
tggacaggcagaagcaatcctgtgaaagtcggcgagcaaatttggattcgtcagcgtgct
aatggggaatggcaattaggacaaattcccgcagcaaattcagcattagtttctcttaat
tcagataatggcgcgattgaagcagtggtgggcggatttagttatgaacaaagtaaattc
aatcgagccacacagtctttagttcaagtgggttcttctattaaaccatttatttacgcg
gcagcattagaaaaaggcttaacgctttctagtgtattacaagacagcccgatttctatt
caaaaaccgggacaaaaaatgtggcaaccgaaaaactcgcctgatcgttatgatggcccg
atgcgtttacgcgtaggattaggtcaatccaaaaatatgattgctattcgtgcgatccaa
acagcaggtattgatttcacagcagaatttttacaacgttttggttttaaacgtgatcaa
tattttgctagcgaagccttagcacttggcgcagcctctttcacaccattagaaatggcg
cgagcttatgcggtgtttgataatggcggtttcctcattgaaccttatatcattgaaaaa
attcaagataacacgggtaaagacttatttattgcaaaccctaaaattgcttgcattgaa
tgtaatgatatacctgtaatttatggcgaaaccaaagacaaaatcaacggctttgccaat
attcctttaggcgagagtgccttaaaaccaacagatgacagcaccaatggcgaagaatta
gatcaacaacctgaaactgtgcctgaactgccagaattacaatcaaatttcaccgcactt
aaagaagatgcgattgatttaatggctgctgcaaaaaatgcctcgtcgaaaatagaatat
gcgccacgtgtcattagtggcgaacttgcttttctcattcgtagtgccttaaatacggca
atttatggcgaacaaggtttagactggaaaggcaccagctggcgcattgcacaaagtatt
aaacgtagcgatataggcggtaaaacaggtactaccaacagttcaaaagtggcttggtat
gcgggatttggtgcaaacttagtcactacaacttatgttgggtttgatgataacaaacga
gtacttgggcgtggagaagcgggtgcgaaaacagccatgccagcttggatcacttatatg
aaaatggctttgagtgataaacctgaacgtaaattgccactgccgccaaaaattgtggaa
aaaaacattgatactttgacaggtttgctttctccaaacggtgggcgcaaagaatatttt
attgtgggaacagaaccgacacgtacctatctttcggaaatgcaagagcgtggttattac
gttcctacagagttacagcaacgcttaaataatgaaggcaatacgccagcgacgcaacca
caagaactcttctaa

DBGET integrated database retrieval system