KEGG   Haemophilus influenzae 723: NTHI723_00488Help
Entry
NTHI723_00488     CDS       T03722                                 

Definition
(GenBank) putative ABC transporter ATP-binding protein
  KO
K16012  ATP-binding cassette, subfamily C, bacterial CydC
Organism
hix  Haemophilus influenzae 723
Pathway
hix02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:hix00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    NTHI723_00488
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hix02000]
    NTHI723_00488
Transporters [BR:hix02000]
 ABC transporters, eukaryotic type
  ABCC (CFTR/MRP) subfamily
   ABCC-BAC subgroup
    NTHI723_00488
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran ABC_membrane AAA_21 SMC_N DUF87 AAA_22 RsgA_GTPase AAA_16 T2SSE MMR_HSR1 AAA_18 AAA_29 FtsK_SpoIIIE AAA_23 DUF815 AAA_7 NACHT Metallophos_3 Roc
Motif
Other DBs
NCBI-ProteinID: AJO90951
UniProt: A0A2S9RV93
LinkDB All DBs
Position
493629..495359
Genome map
AA seq 576 aa AA seqDB search
MRTLLPFIRLFKFAKFPLILGLVLMILGLGSSMGLLTVSGWFLAATAIAGLGTLFNFFYP
SASVRGLAIGRTVMRYFEKIVTHDATFRILSKLRVQVFEKIIPLSPAVLNRYRNSDLLNR
LVSDVDTLDSLYLRLLAPFFTAVFVIIAITIGLSFINIPLALGLGLFLLILLIIIPTVFY
RLGQQFGERLIQARATYRTQFLEFIQAQAELLLFNAEDKLKEKMSVTEKTWQEDQAKEAK
LSGFSTALVLFLNGLLISGMLWFASNANFGTDEYRTAYIALFTFAALAAFEIIMPLGAAF
LHIGQVIAAAERVTEIIEQKPLVEFNGNEEFETKVRLISAKNLNFSYPEQETLVLKNLTL
DLEQGKKIAILGKTGSGKSSLLQLLVRNYDANQGELLLAEKPISTYSEETLRRQICFLTQ
RVHVFSDTLRQNLQFASADKISDEKMIEVLHQVGLSKLLEQEGKGLNLWLGDGGRPLSGG
EQRRLGLARILLNNAPILLLDEPTEGLDRETERQILRLILQHAENKTLIIVTHRLSSIEQ
FDKICVIDNGRLIEEGDYNSLITKENGFFKRLIERV
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atgcgcacattacttccgtttatacgtttatttaaattcgccaaattcccgcttatttta
ggcttggtgctaatgattctaggtttgggctctagtatgggcttgcttaccgtttcaggc
tggtttttagccgctacagccattgcaggactaggcacgctatttaactttttctatcct
tcagccagtgtgcgaggtttagctatcggacgaaccgtcatgcgctattttgaaaaaata
gtaacgcatgatgcaacattccgcattttgtccaaattacgcgtgcaagtatttgaaaaa
atcattcctttaagcccagcggtattaaatcgttatcgcaacagcgatttattaaatcgt
ttagtttccgatgtggatacccttgatagcctctatttacgtttacttgcgccatttttc
actgctgtatttgtaatcattgccataacgattggacttagctttatcaatattccactc
gcacttggtttaggcttatttttgttaattttattaataattatccctactgttttctat
cgactaggacagcaatttggcgaacgcttaatccaagcacgtgcgacctatcgaacccag
tttttagaatttatccaagcacaagccgagcttttattatttaatgcggaagataaatta
aaagaaaaaatgtcagtcacagaaaaaacatggcaggaagatcaagccaaagaagcaaaa
ttaagcggattttctaccgcacttgttctctttcttaatggtttgttgatttctggaatg
ctatggtttgcaagtaacgccaattttggcacagatgaataccgcacggcttatattgca
cttttcacttttgctgcacttgcagcctttgagatcatcatgccactgggtgcagcattt
ttgcatataggtcaagtgattgctgcagcagaacgtgtgaccgaaatcattgagcaaaaa
ccgcttgttgagtttaatggtaacgaggaatttgaaacaaaagtgcggttaatttctgcg
aagaatttaaatttttcctatcccgaacaagaaacactcgtattaaaaaatcttacatta
gatttagaacagggcaaaaaaattgctattttaggcaaaactggaagtggaaaatcttca
cttcttcaacttttagtacgcaattatgatgcgaatcaaggtgagcttttattggcagaa
aaacccatttccacctattcagaagagacattacgccgccaaatttgttttttaactcaa
cgtgttcacgtattcagcgatacacttcgtcaaaatttacaatttgcaagtgcggataaa
atttccgatgaaaaaatgattgaagtactacatcaagttggcttaagtaaattacttgag
caagaaggaaaaggtttaaatctttggcttggggatggcggtcgtccactttctggtggg
gaacaacgccgtttaggtttagcgcgtattttactcaataatgcgccaattttattattg
gatgaaccaacagaaggcttagatcgcgaaactgaacgtcaaattttacgtttaattctg
caacatgccgaaaataaaaccctaattatagtcactcaccgtctcagttcaattgaacaa
ttcgataaaatttgtgtaattgataacggaagattaatcgaagaaggcgattacaatagt
ttaatcaccaaagaaaatgggttctttaaaagattgattgagcgagtataa

DBGET integrated database retrieval system