KEGG   Haemophilus influenzae 723: NTHI723_01074Help
Entry
NTHI723_01074     CDS       T03722                                 

Gene name
tufA_1
Definition
(GenBank) Elongation factor Tu protein
  KO
K02358  elongation factor Tu
Organism
hix  Haemophilus influenzae 723
Brite
KEGG Orthology (KO) [BR:hix00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:hix03012]
    NTHI723_01074 (tufA_1)
   03029 Mitochondrial biogenesis [BR:hix03029]
    NTHI723_01074 (tufA_1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hix04147]
    NTHI723_01074 (tufA_1)
Translation factors [BR:hix03012]
 Eukaryotic Type
  Elongation factors
   NTHI723_01074 (tufA_1)
 Prokaryotic Type
   NTHI723_01074 (tufA_1)
Mitochondrial biogenesis [BR:hix03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    NTHI723_01074 (tufA_1)
Exosome [BR:hix04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   NTHI723_01074 (tufA_1)
  Exosomal proteins of breast cancer cells
   NTHI723_01074 (tufA_1)
  Exosomal proteins of colorectal cancer cells
   NTHI723_01074 (tufA_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW
Motif
Other DBs
NCBI-ProteinID: AJO91509
UniProt: A0A0D0ID86
LinkDB All DBs
Position
complement(1080464..1081648)
Genome map
AA seq 394 aa AA seqDB search
MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKHYGGAARAFDQIDNAPEEKARG
ITINTSHVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHI
LLGRQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLSQYDFPGDDTPIVRGSALQALN
GVAEWEEKILELANHLDTYIPEPERAIDQPFLLPIEDVFSISGRGTVVTGRVERGIIRTG
DEVEIVGIKDTAKTTVTGVEMFRKLLDEGRAGENIGALLRGTKREEIERGQVLAKPGSIT
PHTDFESEVYVLSKDEGGRHTPFFKGYRPQFYFRTTDVTGTIELPEGVEMVMPGDNIKMT
VSLIHPIAMDQGLRFAIREGGRTVGAGVVAKIIK
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaagaaaaatttgaacgtacaaaaccgcacgtaaacgtgggtacaatcggccac
gttgaccacggtaaaacaactttaacagcagcaatcacaaccgtattagcaaaacactac
ggtggtgcagcgcgtgcatttgaccaaattgataacgcgccagaagaaaaagcgcgtggt
attaccatcaacacttcacacgttgaatacgatacaccgactcgccactacgcacacgta
gactgtccgggacacgccgactatgttaaaaatatgattactggtgcggctcaaatggat
ggtgctattttagtagtagcagcaacagatggtcctatgccacaaactcgtgaacacatc
ttattaggtcgccaagtaggtgttccatacatcatcgtattcttaaacaaatgcgacatg
gtagatgacgaagagttattagaattagtagaaatggaagttcgtgaacttctatctcaa
tatgacttcccaggtgacgatacaccaatcgtacgtggttcagcattacaagcgttaaac
ggcgtagcagaatgggaagaaaaaatccttgagttagcaaaccacttagatacttatatt
ccagaaccagaacgtgcgattgaccaaccgttccttcttccaatcgaagatgtgttctca
atctcaggtcgtggtactgtagtaacaggtcgtgtagaacgtggtatcatccgtacaggt
gatgaagtagaaatcgtcggtatcaaagatacagcgaaaactactgtaactggtgttgaa
atgttccgtaaattacttgacgaaggtcgtgcaggtgaaaacatcggtgcattattacgt
ggtaccaaacgtgaagaaatcgaacgtggtcaagtattagcgaaaccaggttcaatcaca
ccacacactgacttcgaatcagaagtgtacgtattatcaaaagatgaaggtggtcgtcat
actccattcttcaaaggttaccgtccacaattctatttccgtacaacagacgtgactggt
actatcgaattaccagaaggcgtggaaatggtaatgccaggggataacatcaagatgaca
gtaagcttaatccacccaatcgcgatggatcaaggcttacgtttcgcaatccgtgaaggt
ggccgtacagtaggtgcaggcgttgttgcgaaaatcatcaaataa

DBGET integrated database retrieval system