KEGG   Haemophilus influenzae 723: NTHI723_01165Help
Entry
NTHI723_01165     CDS       T03722                                 

Gene name
tdk
Definition
(GenBank) Thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
hix  Haemophilus influenzae 723
Pathway
hix00240  Pyrimidine metabolism
hix01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hix00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    NTHI723_01165 (tdk)
Enzymes [BR:hix01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     NTHI723_01165 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22 UvrD_C AAA_14 SNF2_N DUF2075
Motif
Other DBs
NCBI-ProteinID: AJO91590
UniProt: A0A2S9S7E7
LinkDB All DBs
Position
1169126..1169707
Genome map
AA seq 193 aa AA seqDB search
MAKLYFYYSTMNAGKSTTLLQSSYNYRERDMSTLVYTAAIDDRFGVGKVTSRIGISQDAF
LFRSETNLFDEINEHLKKEKVHCVLVDEAQFLSKQQVYQLSDVVDKLKIPVLCYGLRTDF
QAELFEGSKYLLAWADQLEELKTICYCGRKANFVLRLNDQGEVIKEGAQIQIGGNDSYLS
VCRLHYKEKCGQI
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaactctacttctattactccacaatgaacgctggaaaatcaacgacgttgcta
caatcttcctataactatcgtgagcgtgatatgagcacattagtttatacggctgcgatt
gatgatcgttttggcgtgggaaaagtcacatcgcgtattggcatttcgcaagatgccttt
ttatttcgctcggaaaccaatttgtttgatgaaatcaatgagcacttaaaaaaagaaaaa
gtgcattgcgtgttggtggatgaagctcaatttcttagcaaacaacaagtttaccagttg
agtgatgttgttgataaactcaaaatccctgtgctttgttatggcttgcgtacagatttc
caagcggaactttttgaaggaagtaaatatttactggcttgggcggatcaactcgaagaa
ttaaaaacaatttgttattgtggccgcaaggctaattttgttttgcgtttaaatgatcag
ggcgaggtcattaaagaaggtgcacaaattcaaattgggggcaatgattcttatctttct
gtttgccgtttacactataaagaaaagtgcggtcaaatttaa

DBGET integrated database retrieval system