KEGG   Haemophilus influenzae R2866 (nontypeable): R2866_0295Help
Entry
R2866_0295        CDS       T01981                                 

Gene name
menF
Definition
(GenBank) Menaquinone-specific isochorismate synthase
  KO
K02552  menaquinone-specific isochorismate synthase [EC:5.4.4.2]
Organism
hiz  Haemophilus influenzae R2866 (nontypeable)
Pathway
hiz00130  Ubiquinone and other terpenoid-quinone biosynthesis
hiz01100  Metabolic pathways
hiz01110  Biosynthesis of secondary metabolites
hiz01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hiz00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    R2866_0295 (menF)
  09109 Metabolism of terpenoids and polyketides
   01053 Biosynthesis of siderophore group nonribosomal peptides
    R2866_0295 (menF)
Enzymes [BR:hiz01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.4  Transferring hydroxy groups
    5.4.4.2  isochorismate synthase
     R2866_0295 (menF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Chorismate_bind CLN5
Motif
Other DBs
NCBI-ProteinID: ADO80284
LinkDB All DBs
Position
285684..286976
Genome map
AA seq 430 aa AA seqDB search
MYLKQNLMSYLAQAIGELKSQIHAYLQQSTNELARFQVKLDKVDLLAWLKGQSAYPQFYL
HFRDEEKALAALGAVQSFSQLNLAQEFIEESGFPLVGGLQFQGTAQFVLPKMLVEQDNKG
TLVSFFVKDEQSANDTLAHLKTFENLTALSALPKQIPLHTEPRANERTWCDWVNQALVEI
KSGELTKIVLANETTFHLKQAINAYDFLAESEKKNQGCYHFLWAENSYSVFVGSTPERLF
AREYNLLLTEALAGTASVSESEEETQSQANWLLNDEKNLKENWLVVEDISQNLRKQVESF
DVSNVELKPLRKVQHLIRKIRANLTAHYADVNILKAIHPTAAVSGLSQQQAKMILSEIET
FDRGWYAGTLGVMSDVCSEFCVAIRSAFIEGHRIRVFAGAGIVAGSQPLEEWKEIERKAA
GLISLFAEEK
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
gtgtatttaaaacaaaatctaatgagttatttagcgcaggcaataggcgagttaaaatcg
caaattcacgcatatttacagcaatcaacgaatgaacttgcccgttttcaggtaaaactg
gacaaggtcgatttgttggcgtggctgaaaggtcaatctgcgtatccacaattttattta
cattttcgtgatgaagaaaaagcactggctgcgcttggggcagtgcagtcattttcacag
ttaaatttagcgcaagagtttattgaagaaagtggttttccactggtcggcggtttgcaa
tttcaaggtaccgcacaatttgtattacccaaaatgcttgttgaacaggataataaaggc
acgttggtatccttttttgtgaaagatgagcaaagtgcgaatgatactttagctcacctc
aaaacttttgaaaatctcaccgcactttctgcgttaccaaaacaaattcctttgcataca
gagcctcgagctaacgaaagaacttggtgtgattgggtaaatcaggctttggtagaaatt
aaaagtggagagctgacaaaaattgtgttagccaatgaaaccacttttcatttaaagcaa
gcgattaatgcgtacgattttttagcagaaagcgaaaaaaaaaatcaaggttgttatcat
tttttatgggctgaaaattcttattcggtttttgttggttctacgccagaacgcctattt
gctcgtgagtataatttgttgctaacagaggctttggcggggacggcatcggtttctgaa
agtgaggaagaaacgcaatctcaagccaattggttattaaatgacgagaaaaatttaaaa
gaaaattggttggtcgtagaagatatttcgcagaatttacgtaagcaagtagaaagtttt
gatgtaagcaatgtggaattgaaaccgttacgtaaagtacaacatttgattcgtaaaatt
cgtgcaaatttgaccgcacattatgcagatgtaaatatattaaaagcgattcatcctaca
gccgcagtatctggtttgtcacagcaacaagccaaaatgattttgtcagaaattgaaacc
tttgatcgaggctggtatgcgggaacattgggcgtgatgagcgatgtatgttcagagttt
tgtgtggcgattcgttctgcttttattgaaggtcatcgtattcgagtatttgctggcgcg
ggcattgtggcaggctcgcagccattggaagaatggaaagaaattgaacgtaaagcagca
gggttaatttccttgtttgcagaagaaaaatga

DBGET integrated database retrieval system