KEGG   Haemophilus influenzae R2866 (nontypeable): R2866_0570
Entry
R2866_0570        CDS       T01981                                 

Definition
(GenBank) conserved hypothetical protein p53
Organism
hiz  Haemophilus influenzae R2866 (nontypeable)
SSDB
Motif
Pfam: DUF1525
Other DBs
NCBI-ProteinID: ADO80534
LinkDB
Position
566777..567214
AA seq 145 aa
MSIKKSLFLFGLLPLSVFAQGPNPIITVYSTQDYPILHAELASQVYLLDQVEQWENLISQ
RLSANPSVAAQQASQIFQSAEWKQSEEQLKRSYQGLISGWQNGIKKVPAILFQYPGKEDS
VIYGETNIAQALSLWQREITKEGTR
NT seq 438 nt   +upstreamnt  +downstreamnt
atgtctataaaaaaatcactgtttcttttcggtttgttaccactatcagtgttcgcccag
gggcctaatcccataattactgtttattcaacacaagattatccaattcttcacgcggag
cttgcaagccaggtgtatttacttgatcaagttgagcaatgggaaaatttgattagtcag
cgattgagtgcgaatcctagtgtagcagctcagcaagcatctcagatttttcagtctgct
gaatggaaacagtctgaagagcaattaaagcgttcttatcagggccttataagtggttgg
caaaatggaatcaagaaggtgcctgcaattttatttcaatatccgggaaaagaggatagc
gtcatatatggcgaaaccaatattgctcaggcattaagtttatggcaacgagagattaca
aaagaggggacaagatga

DBGET integrated database retrieval system