KEGG   Haemophilus influenzae R2866 (nontypeable): R2866_1014Help
Entry
R2866_1014        CDS       T01981                                 

Gene name
trpE
Definition
(GenBank) Anthranilate synthase component I
  KO
K01657  anthranilate synthase component I [EC:4.1.3.27]
Organism
hiz  Haemophilus influenzae R2866 (nontypeable)
Pathway
hiz00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hiz01100  Metabolic pathways
hiz01110  Biosynthesis of secondary metabolites
hiz01130  Biosynthesis of antibiotics
hiz01230  Biosynthesis of amino acids
hiz02024  Quorum sensing
Module
hiz_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hiz00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    R2866_1014 (trpE)
  09110 Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    R2866_1014 (trpE)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    R2866_1014 (trpE)
Enzymes [BR:hiz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     R2866_1014 (trpE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Chorismate_bind Anth_synt_I_N Chordopox_G2
Motif
Other DBs
NCBI-ProteinID: ADO80959
LinkDB All DBs
Position
complement(1016265..1017821)
Genome map
AA seq 518 aa AA seqDB search
MNIQTQAFIAVTAQPIPYYADTTAIFNTLCQPNSNSLLLDSAEIGSKNSLQSLILVNAAV
KITCLGHNVTFKALNKNGKQVLKEIYPKLTALGKISAVNFEDEFSVQFSPLDNQLDEDSK
LQSATIFDGLRVVSTLYQHSQTPIFLGGLFAYDLVANFIPMDGITLQNDGINCPDYSFYL
AEHLITIDHQNQQATLKSFCFAQEEQVNIAKTSLSIAQKLKNIDHVLSIKSASDEVKTNF
DDPEFTGIVKALKHHINIGDVFQIVPSRRFSLACPNTLASYAQLKQNNPSPYMFYMNDED
FILFGASPESALKYAPENRQLEIYPIAGSRPRGFNAHGNIDPELDARLELELRLDHKEQA
EHLMLVDLARNDIARVCQSGTRKVAELMQVDRYSHIMHLVSRVVGKLRPELDALHAYQAC
MNMGTLTGAPKIKAMQLIYQFEQQKRHSYGGAVGYLTSDGHFDTCIVIRSAFVQNGIAHV
QAGCGEVLDSDPQMEADETRHKAAAVLKAIRQVNTQAK
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgaacattcaaactcaagcctttattgcagtgacagctcaacccattccctattatgct
gacaccaccgctatttttaatacactttgccaacctaattcaaattctcttctactcgac
tctgccgaaatcgggagtaaaaatagtttacaaagtcttattttagttaatgctgcagtt
aagataacttgtttaggtcacaacgtcacatttaaagctttaaataagaatggaaaacaa
gttttaaaagaaatttatccaaaattaaccgcacttggaaaaataagtgcggtcaatttt
gaagacgaattttctgtacaattttcaccacttgataatcaactcgatgaagatagtaaa
ttacagtctgcaactatttttgatggattacgtgttgtttctactctttatcaacatagc
caaacgcctattttcttaggcggattatttgcttacgatctcgtcgcaaatttcattcca
atggatggcattacattgcaaaatgatggtatcaactgccctgattacagtttctatctt
gccgaacatctcattaccatcgatcatcaaaatcaacaagcaacacttaaaagtttctgt
tttgctcaagaagaacaagtcaatattgcgaaaacctcactttctatcgcacaaaaacta
aaaaatattgatcacgttctttctattaaatcggcaagtgatgaagttaaaacaaacttt
gacgatcctgaatttactggtatcgtaaaagccttaaaacaccatattaatattggagat
gttttccaaattgtgccttctcgccgtttctcccttgcttgcccgaatacattagccagt
tatgcccaactcaaacaaaataatccaagcccttatatgttctatatgaatgatgaagac
tttattttgtttggtgcatcgccagaaagtgcgctgaaatatgcgccagaaaatcgtcag
ttagaaatttacccaatcgcaggttcacgccctcgtggttttaatgctcacggcaacatt
gatcctgaattagatgcacgtttagaactagaacttcgccttgatcataaagaacaagca
gaacatttaatgttagttgatttagcacgtaacgacattgctcgagtttgccaaagcggt
acccgtaaagtggctgagttaatgcaggtggatcgctattctcacattatgcatttggtc
tctcgcgtggtgggtaaattacgccctgaattagatgcacttcacgcctatcaagcctgt
atgaatatgggcacattaactggtgcgccaaaaatcaaagcaatgcaacttatttatcaa
tttgagcagcaaaaacgccatagttacggtggtgcggtgggttatctcacttccgatgga
cattttgatacctgtatcgtaattcgttctgctttcgtacaaaatgggatagcccatgta
caagcaggttgcggtgaagtattggattctgatccacaaatggaagccgatgaaacacgc
cacaaagccgcggctgtcttaaaagcaattcgtcaagttaatacacaagcaaaataa

DBGET integrated database retrieval system