KEGG   Haemophilus influenzae R2866 (nontypeable): R2866_1231Help
Entry
R2866_1231        CDS       T01981                                 

Definition
(GenBank) Conserved hypothetical protein
  KO
K01665  para-aminobenzoate synthetase component I [EC:2.6.1.85]
Organism
hiz  Haemophilus influenzae R2866 (nontypeable)
Pathway
hiz00790  Folate biosynthesis
Brite
KEGG Orthology (KO) [BR:hiz00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    R2866_1231
Enzymes [BR:hiz01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.85  aminodeoxychorismate synthase
     R2866_1231
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Chorismate_bind
Motif
Other DBs
NCBI-ProteinID: ADO81169
LinkDB All DBs
Position
1251652..1252638
Genome map
AA seq 328 aa AA seqDB search
MAQSTMQHFIEQANHYGKQRTPFFFLIDFEKEKPLICPLENSAQQGIYFDILGKRNCTIS
PQSIPLNFTKHPMPFSHYQQGFELVQSELQKGNSYLLNLTYPTEISGNLSLEQIFHQTNA
PYKLWLQDQFVCFSPECFINIHDNNIFTYPMKGTINATLPDAENQLLTNEKEQREHYTIV
DLMRNDLSMVAKNIQVKKFRYIDRIKTQKGEILQTSSEIYGKLNENWQNQIGDILEKLLP
AGSISGAPKEKTTQIIQQAEKQKRGYYTGIFGIFDGKTLQSAVAIRFISQVDEKCYFHSG
GGITIHSNVQDEYEELLEKVYLPIEGAD
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atggcacaaagcacaatgcaacattttattgaacaggctaatcattatggcaaacaacgc
acgccatttttctttcttattgattttgaaaaagaaaaacccttgatttgtcctctcgaa
aattctgcacaacaaggtatttattttgatattttaggcaaaagaaattgcacaatttct
ccacaatctatccctcttaatttcaccaaacatccaatgcctttctcgcattatcaacaa
ggttttgaacttgttcaaagtgaattacaaaaaggtaattcttatttattaaatctcacc
taccccactgaaatttcaggtaatttgtcacttgaacaaatttttcatcaaaccaacgca
ccttataaattgtggttacaagatcaattcgtttgcttttcgcctgaatgttttatcaat
attcatgacaacaatatttttacctatcccatgaaagggacaattaatgccacactgccc
gatgcagaaaatcagttactcacaaatgaaaaagaacaacgcgagcattacacgattgtt
gatttgatgcgtaatgatttatccatggtggcaaaaaacattcaggtgaaaaaatttcgt
tatatcgatcgtatcaagacccagaaaggcgaaatactgcaaaccagttctgaaatttac
ggaaaattgaatgaaaactggcaaaatcaaattggggatattttagagaaactgttgcct
gctgggtctattagcggcgcaccaaaagaaaaaaccacacaaattattcagcaagcagaa
aaacaaaaacgcggttattacacgggaatttttggcatatttgatggcaaaacactacaa
agtgcggtggcaattcgatttatttctcaagtagatgaaaaatgttattttcatagtgga
ggtggaattactattcatagcaatgtgcaagatgaatatgaagaattattagaaaaagtc
tatttaccgattgaaggtgcggattaa

DBGET integrated database retrieval system