KEGG   Haemophilus influenzae R2866 (nontypeable): R2866_1364Help
Entry
R2866_1364        CDS       T01981                                 

Gene name
tktA
Definition
(GenBank) Transketolase 1
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
hiz  Haemophilus influenzae R2866 (nontypeable)
Pathway
hiz00030  Pentose phosphate pathway
hiz01100  Metabolic pathways
hiz01110  Biosynthesis of secondary metabolites
hiz01120  Microbial metabolism in diverse environments
hiz01130  Biosynthesis of antibiotics
hiz01200  Carbon metabolism
hiz01230  Biosynthesis of amino acids
Module
hiz_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
hiz_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:hiz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    R2866_1364 (tktA)
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    R2866_1364 (tktA)
Enzymes [BR:hiz01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     R2866_1364 (tktA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transketolase_N Transket_pyr Transketolase_C DXP_synthase_N E1_dh TPP_enzyme_C
Motif
Other DBs
NCBI-ProteinID: ADO81299
LinkDB All DBs
Position
1394677..1396674
Genome map
AA seq 665 aa AA seqDB search
MATRRQLANAIRVLAMDSVQKAKSGHPGAPMGMADIAEVLWRDFLKHNPTNPKWADRDRF
VLSNGHGSMLIYSLLHLTGYDLSIEDLKQFRQLHSKTPGHPEYGYAPGVETTTGPLGQGI
TNAVGMAIAEKTLAGQFNREGHEIVDHHTYVFLGDGCLMEGISHEACSLAGTLGLGKLIA
FYDDNNISIDGHVDGWFSDDTAARFEAYGWQVIRNVDGHDAEQIRAATILAQAEKEKPTL
IICKTIIGFGSPNKSGSHDSHGAPLGDEEIALTRKALGWEYAPFEIPAEYYAEWSAKEKG
SAAEKSWEEKFAAYAKAYPELAAEFKRRVSGELPANWAAESKAFIEKLQANPASIASRKA
SQNAIEAYAHVLPEFLGGSADLASSNLTLWSGSKPIRAHENVGGNYINYGVREFGMSAIM
NGIALHGGFIPYGATFLMFYEYAHNAVRMAALMKQRTLFVYTHDSIGLGEDGPTHQPVEQ
TASLRLIPNLETWRPCDQVESAIAWQQAVERQDGPSALIFTRQNLAQMNRTSAQLDAVKR
GAYVLKDCDGTPELIFIATGSEVELAVQAAEALSAEGKKVRVVSMPSTNRFDKQDAAYRE
SVLPAAVTKRVAIEAGIADFWYKYVGFNGRVVGMNSFGESAPADQLFKLFGFTVENVVAK
AKEIL
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atggcaactcgtagacaattagccaatgcaattcgtgtcttagcaatggattctgtacaa
aaagcaaaatcaggtcaccctggtgcgccaatggggatggcggatattgctgaagtatta
tggcgcgactttttaaaacacaatccaaccaatcctaaatgggctgaccgagatcgtttt
gtactttctaacggccatggttctatgttgatttatagtcttttacatttaactggctat
gatctttctatcgaagatttaaaacaattccgtcaattacattctaaaacccctggccac
ccagaatatggttatgcgcccggtgttgaaaccacgactggccctcttggtcaaggtatt
accaatgctgttggtatggcaattgcagaaaaaacacttgcaggtcaatttaaccgtgaa
ggccatgaaattgtcgatcaccacacttatgtgttcttaggcgatggctgtttaatggaa
gggatctctcacgaggcttgctctttagcgggaacattaggtcttggcaaattaattgca
ttctacgatgacaataatatttccattgatggtcatgttgatggctggttcagcgatgat
actgcagcacgttttgaagcttatggctggcaagtaattcgtaatgtagatggtcacgat
gcagagcaaattcgtgctgctaccattcttgctcaagcagaaaaagaaaaaccaacgtta
ataatttgtaaaaccatcattggttttggttctccaaataaatcaggctctcacgatagc
cacggtgcgccattaggcgatgaagaaatcgctttaactcgcaaagcacttggttgggaa
tatgcgccatttgaaattccagctgaatactatgctgaatggtctgcaaaagagaaaggc
tcagcagcagaaaaatcttgggaagaaaaatttgccgcctatgcaaaagcctatcctgaa
ttagcagcagaatttaaacgtcgtgtttctggcgaattaccagcaaattgggcggcagaa
tccaaagcgttcattgaaaaattacaagcaaatccagcgagcatcgcaagccgtaaagca
tcacaaaatgcaatcgaggcgtacgctcacgtattacctgaattcttaggtggttctgca
gacttagcaagctctaacttaaccttatggagtggttctaaaccgattcgtgcgcatgaa
aacgtaggtggtaactacatcaactacggcgttcgtgaatttggtatgtctgccattatg
aacggtattgctttacacggcggtttcattccttacggcgcaaccttcttaatgttctac
gaatatgctcacaatgcggtgcgtatggcagcattaatgaaacaacgcacattattcgtt
tatacccacgattccatcggtttaggcgaagatgggcctacacaccaaccagttgagcaa
actgcatcattacgcttaattccaaaccttgaaacatggcgtccatgtgaccaagttgaa
tcagccatcgcatggcaacaagcggttgaacgtcaagatggcccaagtgcgttaattttc
actcgtcaaaatcttgctcaaatgaaccgcacttctgcacaattagatgcggttaaacgt
ggtgcttatgtgttaaaagactgtgatggcacacctgagttaatcttcattgcgacaggt
tctgaagtggaattagcagtgcaagcagccgaagcattaagtgctgaaggtaaaaaagta
cgcgttgtttctatgccaagtactaaccgtttcgataaacaagatgcagcgtaccgtgaa
agcgtattacctgcagcggtaaccaaacgtgttgcgattgaagcgggtattgctgacttc
tggtataaatacgttggattcaatggtcgtgttgtcggtatgaatagctttggcgaatcc
gcaccagcagatcaattattcaaactctttggtttcactgttgaaaacgtggtagcaaaa
gcgaaagaaattctttaa

DBGET integrated database retrieval system