KEGG   Halioglobus japonicus: BST95_03020Help
Entry
BST95_03020       CDS       T04687                                 

Definition
(GenBank) peptidyl-dipeptidase
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
hja  Halioglobus japonicus
Brite
KEGG Orthology (KO) [BR:hja00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:hja01002]
    BST95_03020
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hja04147]
    BST95_03020
   04090 CD molecules [BR:hja04090]
    BST95_03020
Enzymes [BR:hja01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     BST95_03020
Peptidases [BR:hja01002]
 Metallo Peptidases
  Family M2
   BST95_03020
Exosome [BR:hja04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BST95_03020
CD molecules [BR:hja04090]
 Proteins
  BST95_03020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M2 DUF2694
Motif
Other DBs
NCBI-ProteinID: AQA17353
LinkDB All DBs
Position
complement(629608..631419)
Genome map
AA seq 603 aa AA seqDB search
MPNTMNLFRLALPAIATATLASATLANPNKTAEAFFEQAGATASEIALRDARAQWIFNTH
ITYDTQQLVIETGRERSLIFLELARQANELLAQDGLSNVNRRNLNRVRQGVNLPAPASEA
ATAELVEIGAHLKNLYSTGKYCPEEGNCLSLRDMELTLSTSRDASEQAELWEGWRTIAPP
MRAPFSRQVELSNQGARDLGFADMGDYWRSRYDMSGDEFSASMERYWDEAKPLYESLQCH
VQAKLTEFYGADVMPGNGMIPAHLTGNMWAQAWSGIENVVMGSNAKAPYNLTQILEDKEM
DEIAMVEMAEMFFVSLGLDPLPDTFWARSQFTKPRDREVVCHASAWDVDSQDDLRIKMCI
QRTEDEVKVIHHELGHNYYQRAYKSQNYFHQGSANPGFHEALGDVIALSVNGNYLHQIGL
LDAAPKADPETEIAGLMKLALDKVAFLPFALVMDKWRWQVFAGEVGPEDYNAAWWKLREQ
YQGVTPPVARDESNFDPGAKYHIPGNVSYTRYFLAHLLQFQLHERMCELAGHKGPLHRCT
IYNSKEAGAALNELMVAGASQPWQDTLEAFSGERDVNPSAMLNYFAPLQTWLDEQNKNRQ
CGW
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
ttgccaaacactatgaacctattccgactggcgctgcccgccatcgccacagccacgctg
gcttcagccacgctggctaaccccaacaagaccgcggaagcattcttcgaacaagccggg
gccaccgcctctgaaattgccctgcgcgatgcccgcgcgcagtggatattcaatacgcat
atcacttacgacacccagcagctggttatcgaaaccggccgggaacgcagcctgatcttt
ctcgagctcgcccgccaggcgaatgaacttctggcccaggatggtttgagtaacgttaat
cgccgcaacctgaatcgggtgcgccaaggggtcaatctgcccgcacccgccagcgaggcc
gccaccgccgagctggtagagatcggggcccacctgaagaacctgtattcaacgggcaaa
tattgccctgaagaaggaaactgcctgtcactgcgcgacatggagctgaccctgagtaca
tcgcgggacgccagcgagcaagctgagttgtgggagggctggcgcacgatcgcaccaccc
atgcgcgcgccctttagccgtcaggtagagctgtccaaccagggagcaagagaccttggg
tttgctgatatgggcgactattggcggagccgttacgacatgtcgggcgacgaattctcc
gccagcatggagcgctactgggatgaagccaagccgctgtacgaatctctgcagtgccat
gtccaagccaagttaaccgagttctatggtgccgatgtcatgcctggcaacggcatgatt
cccgcacacctcacgggcaacatgtgggcccaggcctggtctggcatagaaaatgtggtc
atgggcagtaatgccaaagcaccctacaacctcacccagatcctcgaagacaaggaaatg
gacgagatcgccatggtcgaaatggcagagatgttctttgtctccctggggctggatccg
ctgccagacacgttctgggcccgctcccagttcaccaagcctcgcgatcgcgaggtggtc
tgccacgccagtgcctgggatgtggattcccaggatgacctgcgcatcaagatgtgcatc
cagcgcaccgaagacgaagtgaaagtcatccatcacgagttgggtcacaactactaccag
cgcgcctacaaatcgcagaactattttcatcagggcagtgccaatcccggcttccacgag
gcgctgggcgacgtgattgcgctgtcggtcaatggcaactacctgcatcagatcggtttg
ctggacgctgcacccaaggcagacccggagacagaaattgcggggctgatgaaactggca
ctcgacaaagtggcattcctgccctttgcgctggtcatggacaagtggcgctggcaggta
tttgccggtgaagtcggtccagaagactacaacgccgcctggtggaagctccgtgagcag
taccagggcgtaacgccaccggtagcgcgcgacgaatccaactttgatccgggcgccaag
taccacatcccgggcaatgtgtcctacacacgctacttcctggcccacctactgcaattc
caactgcacgagcggatgtgtgagcttgccggacacaaaggaccactgcaccgctgtacg
atttacaacagcaaggaagcgggagcagccctgaacgagttgatggtggcgggtgcctca
cagccctggcaagacactctggaagcgttcagcggcgagcgcgatgtaaatcccagcgct
atgttgaattactttgccccgctgcagacctggctggacgagcagaataaaaatcgccag
tgcggctggtaa

DBGET integrated database retrieval system