KEGG   Halioglobus japonicus: BST95_12985Help
Entry
BST95_12985       CDS       T04687                                 

Definition
(GenBank) beta-ketoacyl-[acyl-carrier-protein] synthase II
  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Organism
hja  Halioglobus japonicus
Pathway
hja00061  Fatty acid biosynthesis
hja00780  Biotin metabolism
hja01100  Metabolic pathways
hja01212  Fatty acid metabolism
Module
hja_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:hja00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BST95_12985
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BST95_12985
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:hja01004]
    BST95_12985
Enzymes [BR:hja01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.179  beta-ketoacyl-[acyl-carrier-protein] synthase II
     BST95_12985
Lipid biosynthesis proteins [BR:hja01004]
 Fatty acid synthase
  Component type
   BST95_12985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Ketoacyl-synt_C Thiolase_N SpoVAD ACP_syn_III KAsynt_C_assoc
Motif
Other DBs
NCBI-ProteinID: AQA19019
UniProt: A0A2N5YHU9
LinkDB All DBs
Position
complement(2752128..2753369)
Genome map
AA seq 413 aa AA seqDB search
MNGRRVAVTGLGMVSPIGHTVAETWENILAGKSGAAPIETFDVSAYSTQFSCSVRDFDIS
PYLAAKDARKMDTFVQYGMAAGMQAFEDSGFEVTDENAPRVGCAIGSGIGGIGQIEKNSE
IVNNAGPRRISPFFVPGSIINMISGNLSVKYNMQGPNLAVVTACTTGTHNIGLGARMIAQ
GDADAMLVGGAEMATTPVGLGGFAAARALSTRNDDPTAASRPWDRDRDGFVLGDGAGVIM
LEEYESAKARGAHIYAELTGFGMSGDAYHMTLPPEDGRGAAASMANALRDAGIAAEKINY
VNAHGTSTPAGDVAESKAVETVLGSAAAQVAVSSTKSMIGHLLGAAGAVEAIFSVLAIRD
QICPPTINLDNPDEGANLNYVPHTPQEREIHSVLSNSFGFGGTNGTLLFSRPD
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
ttgaacggcagacgcgtggcggtaacaggcctgggtatggtgagtccaatcgggcacacc
gtcgccgagacatgggaaaatatactcgccggcaagagtggcgcagcccccattgagact
tttgatgtctccgcttacagcacccagttcagctgcagtgttcgcgacttcgatatttcg
ccttacctggcagcgaaggacgcgcgcaagatggacacctttgtccagtacggtatggct
gccggtatgcaggcgtttgaagattccggctttgaggtcactgacgaaaacgcgccgcgg
gttggctgtgccattggttccggtatcggcggcataggccagatcgagaagaattctgaa
atcgtcaacaatgcgggcccgcgccgcatatctcctttcttcgtgcccggatccattatc
aatatgatctcgggtaacctgtccgttaaatacaacatgcagggccccaacctggccgtg
gtgactgcctgtaccaccggaacgcataacatcggcctgggtgcgcgcatgattgcacag
ggcgacgcggatgccatgctggttggcggcgctgaaatggcaaccaccccggtgggcctg
ggcggttttgccgcggcacgtgcgctgtccacacgcaacgacgaccccactgcggcgtct
cgcccctgggaccgcgatcgcgatggttttgtgctcggcgatggtgccggtgtcatcatg
ctcgaggagtatgagtcagccaaggcgcgcggcgcccatatctatgcggagctgaccggt
tttggtatgagtggcgatgcttatcacatgaccctgcctcccgaagacggccgcggcgcc
gcagcgtccatggccaatgccttgcgtgacgcgggtattgcggcagaaaaaatcaactac
gtgaacgcacacggtacctctacacctgctggcgacgtcgccgagagcaaggccgtagaa
acggtactgggcagcgctgctgcacaggtggcggtaagttcgaccaagtcgatgatcggc
cacctgcttggcgccgccggagcggtagaagctatcttctcggtcctggcgatccgcgac
cagatttgcccgccgaccattaatctcgacaaccccgatgaaggggccaacctgaactac
gtgccacacaccccccaggaacgcgagattcacagcgttctgtccaactcgtttggattc
ggcggtaccaacggcacgctgctgttcagtcgtcctgactga

DBGET integrated database retrieval system