KEGG   Halioglobus japonicus: BST95_14620Help
Entry
BST95_14620       CDS       T04687                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
hja  Halioglobus japonicus
Pathway
hja00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:hja00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BST95_14620
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hja02000]
    BST95_14620
Enzymes [BR:hja01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BST95_14620
Transporters [BR:hja02000]
 Other Transporters
  Pores ion channels [TC:1]
   BST95_14620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_3 GST_N_4 GST_C Tom37
Motif
Other DBs
NCBI-ProteinID: AQA19295
UniProt: A0A2N5YH09
LinkDB All DBs
Position
3110282..3110929
Genome map
AA seq 215 aa AA seqDB search
MIKIYGVHGSPFVRKVFIALDYKDIPYEIVAQMPFSGDQDYLKINPTGKIPALVDGDLTI
GDSKVICQHLENAYPERPLYPEDVADKARAHWYEDFCGGQVAELAAGIFFQRFMRPLAFK
QDPDEELIAKITEKKLPPVLDYLESIVPAEGFVFGEFMMADLCIASPFFNAGYAGYEVDA
EKWPNVAGLIARVREQPHVKAVLEKEAKALGLAAA
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgatcaagatttacggtgtgcacggctcaccctttgtgcgcaaggttttcatcgccctg
gactacaaagacatcccctatgagatcgttgcccagatgcccttctccggcgaccaggac
tacctgaagatcaatcccaccggcaagatccccgcactggttgatggcgacctgacaatc
ggcgattccaaggtcatctgccaacatctggagaacgcctatcctgagcgcccgctgtac
cccgaggatgtagcagacaaagcacgcgcccattggtatgaagatttctgcggtggtcag
gtcgcggaattggcagcaggcatctttttccagcgctttatgcgtccactggcgttcaag
caggatccggacgaggaactgatcgccaaaatcacagagaagaaactcccaccggtgctg
gactacctggagagcattgtacccgctgaaggcttcgtctttggcgaatttatgatggcc
gacctctgtatcgcttctcctttctttaatgctggatatgccggctacgaagtagacgct
gaaaaatggcccaacgttgccggccttattgcacgtgtcagggaacagccacacgtaaaa
gcagtgctggagaaagaagccaaagcgctgggactggcggctgcctga

DBGET integrated database retrieval system